KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1118Help
Entry
llmg_1118         CDS       T00475                                 

Gene name
pfk
Definition
(GenBank) Pfk protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00010  Glycolysis / Gluconeogenesis
llm00030  Pentose phosphate pathway
llm00051  Fructose and mannose metabolism
llm00052  Galactose metabolism
llm00680  Methane metabolism
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01120  Microbial metabolism in diverse environments
llm01130  Biosynthesis of antibiotics
llm01200  Carbon metabolism
llm01230  Biosynthesis of amino acids
llm03018  RNA degradation
Module
llm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_1118 (pfk)
   00030 Pentose phosphate pathway
    llmg_1118 (pfk)
   00051 Fructose and mannose metabolism
    llmg_1118 (pfk)
   00052 Galactose metabolism
    llmg_1118 (pfk)
  Energy metabolism
   00680 Methane metabolism
    llmg_1118 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    llmg_1118 (pfk)
Enzymes [BR:llm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     llmg_1118 (pfk)
Protein phosphatases and associated proteins [BR:llm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     llmg_1118 (pfk)
Messenger RNA biogenesis [BR:llm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     llmg_1118 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CAL97712
UniProt: A2RKA2
Position
1078182..1079204
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDK
IGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMGRNAGDIALNA
GIAAGADDICIPEKEFKFENVVNNINKGYEKGKNHHIIVLAEGVMTGEEFATKLKEAGYK
GDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGIRNEELVESPILGT
AEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNLN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcagttttgacttctggtggtgatgccccagggatgaatgcggctatt
cgtgcagttgttcgcaaagcaatttctgaaggtatcgaagtttacggtatcaatcacgga
tatgcgggcatggttgcgggagacattttcccgcttacgtcagcttcagttggtgataaa
atcggtcgtggtggtacattcttgtactcagcacgttacccagaatttgctcaagtagaa
ggacaacttgctgggattgagcaacttaaaaaattcggtatcgaaggtgtcgttgtaatc
ggtggtgacggatcttaccatggagctatgcgtcttacagaacatggtttcccagctgtt
ggacttccaggcacaatcgataacgatatcgtaggaactgattttacaattggttttgat
acagctgtttcgacagtcgtagatgccttggataaaatccgtgatacttcatcatcacat
aaccgtactttcgttgtagaagtaatgggacgtaatgctggagatatcgctttgaatgct
ggtatcgctgctggtgcagatgatatttgtattccagaaaaagaatttaagtttgaaaac
gtagttaacaacattaacaaaggctacgaaaaaggtaaaaatcaccacatcatcgttctt
gctgaaggcgttatgactggtgaagaatttgctacaaaacttaaagaagctggttataaa
ggagaccttcgtgtttctgttcttggacacatccaacgtggtggttcaccaacagctcgt
gaccgtgttcttgcttcacgtatgggagctcgtgccgttgaattgcttcgtgatggaatc
ggtggcgtagccgttggtatccgtaatgaagaacttgtagaaagtccaattctcggaact
gctgaagaaggagcactctttagtttgactactgaaggtggcatcaaagtaaacaacccg
cataaagcaggtcttgaactttaccgtcttaactcagcactcaacaatcttaaccttaac
taa

DBGET integrated database retrieval system