KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1295Help
Entry
llmg_1295         CDS       T00475                                 

Gene name
hisD
Definition
(GenBank) HisD protein
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00340  Histidine metabolism
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01230  Biosynthesis of amino acids
Module
llm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    llmg_1295 (hisD)
Enzymes [BR:llm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     llmg_1295 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CAL97888
UniProt: A2RKS2
Position
complement(1264356..1265663)
Genome map
AA seq 435 aa AA seqDB search
MLKQIDYQGSLEEVANKFQGRKAEVSEEVNKSVQEIVNAIRKEGDSALFSYAKKFDGYNA
DKNNLLVTRKEREEGLEKIDENYFRILRRTKSQIEEFHKHQLGNSWSIYKENGVIMGQIA
RPLERVALYVPGGTAAYPSTVIMNAVPALLAGVKEIIMITPVKSDGQVNANILAAAEVCG
IETIYKVGGAQAVAAVAYGTDSIPKVDKIVGPGNIFVATAKKICYGMVDIDMIAGPSEVL
VIADEKANPKYIAADLMAQAEHDKLASAILVTTSESLVQKVDEELEKQVQSLERREIIES
SVSNYGGAIVVKSIDEAFEVSNQLAPEHLEVLTSAPLAQLPKIKNAGSIFLGEYTPEPLG
DYMSGSNHVLPTGGTAKFYSGLGVYNFVKYSTYSYYPKEILADFQEDVVTFAKSEGLSAH
ANSISVRFDDEKKEK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaaattgattatcaaggaagtcttgaagaagttgcaaataaatttcaagga
cgaaaagccgaagtttcagaagaagtaaataaaagtgttcaagaaattgtcaatgctatt
cgtaaagaaggtgattctgccttatttagctatgcaaaaaagtttgatggatataatgct
gacaaaaataatttacttgtcacgcgcaaggagcgcgaagaaggcttagaaaaaattgat
gaaaattactttagaattctgcgtcgtaccaaatcacaaattgaagaatttcataagcat
caattaggaaattcatggagcatttataaagaaaatggggttatcatgggtcaaattgca
cgtcctttagaacgtgtcgccctttacgttccaggtggcacagcagcctatccttcaaca
gttattatgaacgcagtgcccgcacttttagcaggggttaaagaaattattatgattaca
ccagttaagtctgacgggcaagtgaatgcaaatattttagccgccgctgaagtttgtgga
attgaaacaatctataaagtcggtggcgctcaagctgtggccgccgttgcttacgggaca
gactctattcctaaagttgataagattgtcggacccggaaatatttttgtagccacggcc
aagaaaatttgttacggtatggttgatattgatatgattgcaggaccgtcagaagttttg
gtcattgctgacgaaaaggcaaatccaaaatatatagccgccgatttaatggcgcaagca
gaacatgataaacttgcgtcagcgattttagtgacaacttctgaaagtcttgttcaaaaa
gtagatgaagaattagaaaaacaagttcaaagtttagaacgtcgtgaaattattgaaagt
tctgtcagtaattatggcggtgccattgttgtcaaatctattgacgaagcctttgaagtt
tctaatcaattggctccggaacatttagaagttttgactagtgcccctttagcccaactt
ccaaaaatcaaaaatgctggttcaatctttcttggagaatacacgccagaaccattgggc
gactacatgtcaggaagtaatcatgtcttacctactggtggaacggccaagttttattct
ggcttaggcgtctacaattttgtcaaatattcaacttatagttattatcctaaagaaatt
ttggcggatttccaagaagatgttgtaacttttgctaaatcagaaggattgagtgctcat
gccaattcaatttctgtgagatttgatgatgaaaaaaaggagaaataa

DBGET integrated database retrieval system