KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1337Help
Entry
llmg_1337         CDS       T00475                                 

Gene name
folE
Definition
FolE protein (EC:3.5.4.16)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    llmg_1337 (folE)
Enzymes [BR:llm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     llmg_1337 (folE)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     llmg_1337 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1313335..1314384)
Genome map
AA seq 349 aa AA seqDB search
MQTTYLSMGSNIGDRQYYLHEAIRLLGKHPKIMIEKVSNFYESSPVGGVKQDDFTNLALK
VATLLEPLELLDFIHEVELSLNRERKIHWGPRTIDIDIIFYGNSEIQEENLIVPHKEAFN
RLFVLKPIFELLSNDFKYYEPIREAIAKLSESEQELHVIEEEKSPKNRIEEAVKEILFAV
GENPNREGLLETPARVAKMYEEILSSQRLTNFNEYKLFEIDSSKNDSIVLIKDIPFYSMC
EHHMLPFFGKAHVAYIPDGGRIIGLSKIPRLVNYVSRKLSVQENITHDIADILTDILKPK
GVAVLVEGRHMCVEMRGVKKVNSLTKTSYFLGEFKENGEKRMEFLESLL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaacttatttaagcatgggaagtaatattggggaccgtcagtattatttacat
gaagccattcgtttattgggaaaacacccgaaaattatgattgaaaaagtatcaaatttt
tatgaaagttctccagttggtggcgtcaaacaagatgattttacaaatttagctttaaag
gtggccacactacttgaacccttagaattattagattttattcatgaagttgaactttct
ttaaatcgtgagcgaaaaattcactggggaccaagaacaattgatattgatattattttc
tatggaaattcagaaattcaagaagaaaatttgattgttccacataaagaagcttttaat
cgtttatttgttttaaagcctatatttgagcttttaagcaatgattttaagtattatgag
ccaattcgcgaggcgattgctaaactttcagaaagtgagcaagaactgcatgtgattgaa
gaagaaaagtctccaaaaaatcgtattgaagaggcggtcaaagaaattctttttgcagtg
ggtgagaatccaaatcgagagggattgcttgaaactcctgccagagtggctaaaatgtat
gaagaaattctttcatcacaacgtttgacaaactttaatgaatacaaactttttgaaatt
gattcttctaagaatgattcaattgtgctgattaaagatattccattttattcaatgtgt
gagcatcacatgctaccattctttggaaaggctcatgttgcttatattcctgatggtgga
cgcatcattggattatcgaaaattccccgtctagttaattatgtttctcgtaaactttcg
gtgcaagaaaatattactcatgatattgccgatattttgacggatattttaaaacccaaa
ggagtggctgttcttgttgagggacgtcacatgtgcgtggaaatgcgcggtgtgaaaaaa
gtaaattcgttgaccaaaacttcttatttcttaggtgaatttaaagaaaacggcgaaaaa
agaatggaatttttagaaagtcttttatga

DBGET integrated database retrieval system