KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1424Help
Entry
llmg_1424         CDS       T00475                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    llmg_1424 (tpiA)
   01230 Biosynthesis of amino acids
    llmg_1424 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_1424 (tpiA)
   00051 Fructose and mannose metabolism
    llmg_1424 (tpiA)
   00562 Inositol phosphate metabolism
    llmg_1424 (tpiA)
Enzymes [BR:llm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     llmg_1424 (tpiA)
Exosome [BR:llm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   llmg_1424 (tpiA)
  Exosomal proteins of bladder cancer cells
   llmg_1424 (tpiA)
  Exosomal proteins of melanoma cells
   llmg_1424 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1390877..1391635)
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTLSEAQAFVEAVKNNLPSSDNVESVIGAPALFLAPMAYLRQGSEL
KLAAENSYFENAGAFTGENSPAAIVDLGIEYIIIGHSERREYFHETDEDINKKAKAIFAA
GATPILCCGETLETFEAGKTAEWVSGQIEAGLAGLTAEQVSNLVIAYEPIWAIGTGKTAT
NEIADETCGVVRSTVEKLYGKEVSEAVRIQYGGSVKPETIEGLMAKENIDGALVGGASLE
ADSFLALLEMYK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattatcgctggtaactggaaaatgaataaaactttgtcagaagca
caagcttttgttgaagctgttaaaaataacttgccttcatctgataatgttgaatcagtt
atcggtgcacctgctcttttcctcgctcctatggcttaccttcgtcaaggttcagaattg
aaacttgctgctgaaaatagctacttcgaaaatgctggagcattcactggtgaaaacagc
ccagctgcaatcgttgaccttggtattgaatacatcatcatcggtcacagcgaacgtcgt
gaatatttccacgaaactgacgaagacatcaacaaaaaagcaaaagcaatcttcgctgct
ggagcaactccaatcctttgttgtggtgaaactttggaaacttttgaagctggtaaaaca
gctgaatgggtttcaggtcaaatcgaagctggtcttgcaggattgactgctgaacaagtt
tcaaacttagttatcgcttacgaaccaatctgggcaatcggaactggtaaaactgcgaca
aacgaaattgctgacgaaacttgtggtgttgtacgttcaacagttgaaaaactttacgga
aaagaagtttcagaagctgtacgtatccaatacggtggatcagtaaaacctgaaacaatc
gaaggattgatggctaaagaaaacatcgacggtgccctcgttggtggagcttcacttgaa
gctgatagcttccttgcattgcttgaaatgtacaaataa

DBGET integrated database retrieval system