KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1465Help
Entry
llmg_1465         CDS       T00475                                 

Gene name
murC2
Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    llmg_1465 (murC2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    llmg_1465 (murC2)
Enzymes [BR:llm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     llmg_1465 (murC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1438912..1440261
Genome map
AA seq 449 aa AA seqDB search
MTIKTSFAKFAGNSSRFVLEKFFKRGSTLPGKIALKFDPEILKSLTKNYEIIVVTGTNGK
TLTTALTVGILEKAFGPVVTNPTGANMITGIVSTFLKAPKAKTGEKKFAVLEIDEASLPK
ITEYIKPSLFVFTNIFRDQMDRYGEIYTTYDFIVKGAANSPKGTVLLNGDSPLFNSKKLV
NPVKYYGFNHESHEATHAHYNTEGIVCPVCHHILAYKMNTYANLGNYICENCGFSRPELD
YQLTELSEITNTSSKFVIDGTDYKINVGGLYNIYNALAAVSVAEYFNVPKETIAAGFELS
KAVFGRQETLEIDGKKVTIVLIKNPVGANQALEMMKLANYPFTLVSLLNANYADGIDTSW
IWDANFELINDMEIDQIITGGVRSSEMARRMRVTGFDAQKISERKELSEVLEAIKESQKD
HVYILATYTAMLQMRELLAEGHYLGKEMR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaaaacttcatttgcaaagtttgctggtaattcatcgcgctttgtcttggaa
aaatttttcaagcgtggctcaactttaccaggaaaaattgctttaaaatttgaccctgaa
attcttaaatcactgactaaaaattatgaaatcattgttgtgactgggacaaatggaaaa
acattgaccacagcactgaccgtggggattttagaaaaggcttttggaccagttgtgaca
aatccaactggagccaatatgattacggggattgtatctacctttttgaaagctcccaaa
gcgaaaactggtgaaaagaaatttgctgtccttgagattgatgaagcgagtttgccaaaa
atcactgaatacatcaaaccttcattatttgttttcacaaatattttccgtgaccaaatg
gaccgctatggcgagatttacaccacctacgatttcatcgtcaaaggtgcggcaaatagt
cctaaaggtactgttttattaaatggtgatagtccacttttcaactcaaaaaaattagtt
aatcctgtaaaatattatggctttaaccacgaaagtcatgaagctactcatgctcattac
aataccgaggggattgtttgtccagtctgtcaccatattttggcttacaagatgaacacc
tatgctaacttgggaaattatatttgtgaaaattgtggctttagtcgtccagaattagat
tatcaactgacagaattatccgagattacaaatacttcttctaaatttgtcattgatggg
acagattataaaattaatgttggcggactttataatatttataatgctctcgctgctgta
tctgtcgctgaatatttcaatgtgccaaaagaaacaattgcggctggttttgaactttcc
aaagcagtttttggtcgacaagaaactcttgaaatcgatggaaaaaaagtaaccattgtt
ttgataaaaaatccagtaggtgcgaatcaagcccttgaaatgatgaaattagccaattat
cctttcactttagttagccttttgaatgccaattatgctgacggaattgacacaagttgg
atttgggatgctaattttgaattaattaatgacatggaaattgaccaaattatcacaggc
ggtgttcgttcatctgaaatggctagacgtatgcgagtgactggatttgatgcccaaaag
atttccgagcgtaaagaactttcagaagtattagaggcaatcaaagaaagtcaaaaagat
catgtctatattttggcaacttatactgccatgttgcaaatgcgtgaactactggctgaa
ggtcattatcttggaaaggaaatgcgttaa

DBGET integrated database retrieval system