KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1706Help
Entry
llmg_1706         CDS       T00475                                 

Gene name
pepV
Definition
dipeptidase PepV (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:llm01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:llm00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1680613..1682031)
Genome map
AA seq 472 aa AA seqDB search
MTTIDFKAEVEKRKDALMEDLFSLLRIDSAMDMEHADAENPFGPGPRKALDAFLKIAERD
GYTTKNYDNYVGHFEYENGANADAEVLGIIGHLDVVPAGSGWDSNPFEPEIRNGNLYARG
ASDDKGPTVACYYALKILKELNLPLSKKIRFIVGTNEETGWADMDYYFEHCELPLPDFGF
SPDAEFPIINGEKGNITEYLHFSGKNAGQVVLHSFKAGLAENMVPESATAVISGAKDLEA
ALEKFVAEHASKNLRFDLEEADGKATITLYGKSAHGAMPEKGINGATYLTLFLNQFDFAD
GAAAFIKVGAEKLLEDHEGEKLGTAFVDELMENTSMNAGVWSFDENGEGKIALNFRFPQG
NSPERMQEILAKLDGVVEVELSKHLHTPHYVPMSDPLVSTLIDVYEKHTGLKGYETIIGG
GTFGRLLERGVAYGAMFEGEPDSMHQANEMKPVENIYKAAVIYAEAIYELAK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacaactattgattttaaagctgaagttgaaaagcgtaaggacgctttgatggaagat
ttgtttagccttttgcgcattgattctgcaatggatatggaacatgcagatgctgaaaat
ccatttggccctggtccaagaaaagctttggatgctttcttgaaaattgccgaacgtgat
ggttatacaactaaaaattatgataactatgttggacattttgaatatgaaaacggagca
aatgctgatgccgaagttctcggaattattggtcacttagatgttgttcctgctggttcc
ggttgggattcaaatccatttgagccagaaatccgtaatgggaatctctatgctcgtggt
gcttctgatgataaaggaccaacagttgcatgttactatgcactcaaaattttgaaagaa
cttaatcttccattatctaaaaaaatccgtttcatcgttggtacaaacgaagaaacaggt
tgggcagatatggattactactttgagcactgtgaattgccgttgcctgattttggtttc
tcacctgatgctgagttcccaattatcaatggtgaaaaagggaatatcacagaatatctc
catttctcaggtaaaaatgctggtcaagttgttcttcacagctttaaagcaggtcttgca
gaaaatatggttccagaatcagcaactgcagtgatttcaggtgctaaagatttagaagct
gcacttgaaaaatttgtagctgaacatgcaagcaaaaatcttcgttttgaccttgaagag
gctgatggaaaagcaacaattacgctttatggtaaatcagcgcatggtgcgatgccagaa
aaagggattaatggagcaacttatcttactttgttcttgaatcaatttgactttgctgac
ggtgctgctgccttcattaaagttggggctgaaaaacttcttgaagatcatgaaggtgaa
aaattaggtacagcttttgttgatgaattgatggaaaatacctcaatgaatgctggtgtt
tggtcatttgatgaaaatggtgaaggtaaaatcgccctcaatttccgtttcccacaaggg
aacagcccagagcgtatgcaagaaattcttgctaaacttgatggggttgttgaagttgaa
ctttcaaaacacctccacacacctcactatgttccaatgtcagacccacttgtatcaaca
ttgattgatgtttatgaaaaacacactggtcttaaaggctatgaaacaatcattggtggt
ggaactttcggtcgtctgttggaacgtggtgttgcttatggagcaatgtttgaaggagaa
ccagattcaatgcaccaagcgaatgaaatgaaacctgttgagaatatctacaaagcggca
gtgatttatgctgaagcaatttatgaacttgcaaaataa

DBGET integrated database retrieval system