KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1706Help
Entry
llmg_1706         CDS       T00475                                 

Gene name
pepV
Definition
dipeptidase PepV (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    llmg_1706 (pepV)
  Amino acid metabolism
   00300 Lysine biosynthesis
    llmg_1706 (pepV)
Enzymes [BR:llm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     llmg_1706 (pepV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1680613..1682031)
Genome map
AA seq 472 aa AA seqDB search
MTTIDFKAEVEKRKDALMEDLFSLLRIDSAMDMEHADAENPFGPGPRKALDAFLKIAERD
GYTTKNYDNYVGHFEYENGANADAEVLGIIGHLDVVPAGSGWDSNPFEPEIRNGNLYARG
ASDDKGPTVACYYALKILKELNLPLSKKIRFIVGTNEETGWADMDYYFEHCELPLPDFGF
SPDAEFPIINGEKGNITEYLHFSGKNAGQVVLHSFKAGLAENMVPESATAVISGAKDLEA
ALEKFVAEHASKNLRFDLEEADGKATITLYGKSAHGAMPEKGINGATYLTLFLNQFDFAD
GAAAFIKVGAEKLLEDHEGEKLGTAFVDELMENTSMNAGVWSFDENGEGKIALNFRFPQG
NSPERMQEILAKLDGVVEVELSKHLHTPHYVPMSDPLVSTLIDVYEKHTGLKGYETIIGG
GTFGRLLERGVAYGAMFEGEPDSMHQANEMKPVENIYKAAVIYAEAIYELAK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacaactattgattttaaagctgaagttgaaaagcgtaaggacgctttgatggaagat
ttgtttagccttttgcgcattgattctgcaatggatatggaacatgcagatgctgaaaat
ccatttggccctggtccaagaaaagctttggatgctttcttgaaaattgccgaacgtgat
ggttatacaactaaaaattatgataactatgttggacattttgaatatgaaaacggagca
aatgctgatgccgaagttctcggaattattggtcacttagatgttgttcctgctggttcc
ggttgggattcaaatccatttgagccagaaatccgtaatgggaatctctatgctcgtggt
gcttctgatgataaaggaccaacagttgcatgttactatgcactcaaaattttgaaagaa
cttaatcttccattatctaaaaaaatccgtttcatcgttggtacaaacgaagaaacaggt
tgggcagatatggattactactttgagcactgtgaattgccgttgcctgattttggtttc
tcacctgatgctgagttcccaattatcaatggtgaaaaagggaatatcacagaatatctc
catttctcaggtaaaaatgctggtcaagttgttcttcacagctttaaagcaggtcttgca
gaaaatatggttccagaatcagcaactgcagtgatttcaggtgctaaagatttagaagct
gcacttgaaaaatttgtagctgaacatgcaagcaaaaatcttcgttttgaccttgaagag
gctgatggaaaagcaacaattacgctttatggtaaatcagcgcatggtgcgatgccagaa
aaagggattaatggagcaacttatcttactttgttcttgaatcaatttgactttgctgac
ggtgctgctgccttcattaaagttggggctgaaaaacttcttgaagatcatgaaggtgaa
aaattaggtacagcttttgttgatgaattgatggaaaatacctcaatgaatgctggtgtt
tggtcatttgatgaaaatggtgaaggtaaaatcgccctcaatttccgtttcccacaaggg
aacagcccagagcgtatgcaagaaattcttgctaaacttgatggggttgttgaagttgaa
ctttcaaaacacctccacacacctcactatgttccaatgtcagacccacttgtatcaaca
ttgattgatgtttatgaaaaacacactggtcttaaaggctatgaaacaatcattggtggt
ggaactttcggtcgtctgttggaacgtggtgttgcttatggagcaatgtttgaaggagaa
ccagattcaatgcaccaagcgaatgaaatgaaacctgttgagaatatctacaaagcggca
gtgatttatgctgaagcaatttatgaacttgcaaaataa

DBGET integrated database retrieval system