KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1894Help
Entry
llmg_1894         CDS       T00475                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    llmg_1894
   01230 Biosynthesis of amino acids
    llmg_1894
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_1894
  Energy metabolism
   00680 Methane metabolism
    llmg_1894
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    llmg_1894
Enzymes [BR:llm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     llmg_1894
Exosome [BR:llm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   llmg_1894
  Exosomal proteins of melanoma cells
   llmg_1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1873268..1873849
Genome map
AA seq 193 aa AA seqDB search
MTEVYFIRHSLRDNAAYDDMDVPLTAEGEKRALILADAFEHTSIDQIFSSPFQRSVRTLN
PLAHSKNLEIQLISDLRERNVGHEIADFWPFAKRQWKDFDYKLADGESLREVQNRNISAL
EKILATSKNQKVAIGTHGTSLSTILNFYQPDFQFQDFQSLAGKMPYVIKMDFAENNYLTH
QVIEIDYDNKKSY
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtttattttattcgacattctcttagagataatgcagcctatgacgatatg
gatgttccgctgactgccgagggtgaaaaacgcgcacttatcttagctgatgcttttgaa
catacttcgattgatcaaattttttccagtccatttcaacgttctgttcgtaccctgaat
cctcttgctcactctaaaaatcttgaaattcaactcatttctgatttgagagaaagaaat
gttggccatgaaatagctgatttttggccttttgcaaagcgacaatggaaagattttgat
tataaacttgctgacggagaatcattacgtgaagttcaaaatcgtaatatttcagccctt
gaaaagattttagcaacttctaaaaatcaaaaagttgcaatcggaactcatggtacttct
ctttctaccattttaaatttttatcaaccagactttcagtttcaagattttcaatcttta
gctggcaaaatgccctatgtcatcaaaatggactttgctgaaaataattatctgacccac
caagtcattgaaattgattatgacaataaaaaaagttactga

DBGET integrated database retrieval system