KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1894Help
Entry
llmg_1894         CDS       T00475                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    llmg_1894
   01230 Biosynthesis of amino acids
    llmg_1894
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_1894
  Energy metabolism
   00680 Methane metabolism
    llmg_1894
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    llmg_1894
Enzymes [BR:llm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     llmg_1894
Exosome [BR:llm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   llmg_1894
  Exosomal proteins of melanoma cells
   llmg_1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1873268..1873849
Genome map
AA seq 193 aa AA seqDB search
MTEVYFIRHSLRDNAAYDDMDVPLTAEGEKRALILADAFEHTSIDQIFSSPFQRSVRTLN
PLAHSKNLEIQLISDLRERNVGHEIADFWPFAKRQWKDFDYKLADGESLREVQNRNISAL
EKILATSKNQKVAIGTHGTSLSTILNFYQPDFQFQDFQSLAGKMPYVIKMDFAENNYLTH
QVIEIDYDNKKSY
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtttattttattcgacattctcttagagataatgcagcctatgacgatatg
gatgttccgctgactgccgagggtgaaaaacgcgcacttatcttagctgatgcttttgaa
catacttcgattgatcaaattttttccagtccatttcaacgttctgttcgtaccctgaat
cctcttgctcactctaaaaatcttgaaattcaactcatttctgatttgagagaaagaaat
gttggccatgaaatagctgatttttggccttttgcaaagcgacaatggaaagattttgat
tataaacttgctgacggagaatcattacgtgaagttcaaaatcgtaatatttcagccctt
gaaaagattttagcaacttctaaaaatcaaaaagttgcaatcggaactcatggtacttct
ctttctaccattttaaatttttatcaaccagactttcagtttcaagattttcaatcttta
gctggcaaaatgccctatgtcatcaaaatggactttgctgaaaataattatctgacccac
caagtcattgaaattgattatgacaataaaaaaagttactga

DBGET integrated database retrieval system