KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1991Help
Entry
llmg_1991         CDS       T00475                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00010  Glycolysis / Gluconeogenesis
llm00071  Fatty acid degradation
llm00350  Tyrosine metabolism
llm00625  Chloroalkane and chloroalkene degradation
llm00626  Naphthalene degradation
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01120  Microbial metabolism in diverse environments
llm01130  Biosynthesis of antibiotics
llm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_1991 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    llmg_1991 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    llmg_1991 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    llmg_1991 (adhA)
   00626 Naphthalene degradation
    llmg_1991 (adhA)
Enzymes [BR:llm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     llmg_1991 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N DZR Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CAL98561
UniProt: A2RMM7
Structure
PDB: 

Jmol
Position
complement(1978043..1979065)
Genome map
AA seq 340 aa AA seqDB search
MKAAVVRQNPDGYADVVEKELRMIKPNEALLDMEYCGVCHTDLHVAAGDYGNKAGTVLGH
EGIGIVKEIGSEVTSLKVGDRVSVAWFFEGCGHCEYCVSGNETFCREVKNAGYSVDGGMA
EQAIVTADYAVKVPEGLDPIEASSITCAGVTTYKAIKVSGVKPGDWQVIFGAGGLGNLAI
QYAKNFFGAKVIAVDINQDKLDLAKKIGADVIINSGEVNPIDEIKKITGGLGAQSAVVCA
VARIAFEQAVASLKPMGKMVAVALPNTEMTLSVPTVVFDGVEVAGSLVGTRLDLAEAFQF
GAEGKVKPIVATRKLEEINEIIDEMKAGKIEGRMVIDFTK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtagtacggcaaaatccggatggctatgcggatgttgttgaaaaggaa
cttcggatgattaagcccaatgaagctttactcgacatggaatattgtggagtctgtcat
acagacttgcatgtagcagcaggcgattatggcaacaaagctggaacggtccttggtcat
gaaggaatcggtattgtcaaagaaattggtagtgaagtcacttccttaaaagttggagat
cgcgtgtcagtcgcttggtttttcgaaggatgtgggcattgcgaatactgtgtttctggt
aatgaaactttttgtcgagaggtcaaaaatgctggttattcagttgacggtggaatggcc
gaacaagcgattgtaacagctgattatgcggtaaaagttccagagggacttgatcctatt
gaagcaagttcaatcacttgtgctggagttacgacttacaaagcaatcaaggtttctgga
gttaagccaggagattggcaagtcatctttggtgccggtggactaggtaatctagctatt
caatacgctaaaaatttttttggggcaaaagtaattgcagttgatattaatcaagataaa
ttagacttagctaaaaaaattggtgcagatgtgattatcaattctggtgaagtcaatcca
attgatgaaataaaaaaaatcactggtggtttaggagcacaaagtgctgttgtttgcgcc
gttgcaagaatagcatttgaacaagcagtcgcttctttgaaaccaatgggtaaaatggtt
gcggtggcactgcctaataccgaaatgactttgtctgttccgacagttgtttttgatggt
gtggaagttgctggctcacttgttggaacaagacttgatttagcagaagcatttcaattt
ggtgctgaaggtaaagtcaaaccaattgttgcgacacgcaagcttgaagaaatcaatgag
attattgatgaaatgaaagcaggaaaaattgaaggccggatggtcattgattttactaaa
taa

DBGET integrated database retrieval system