KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1991Help
Entry
llmg_1991         CDS       T00475                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    llmg_1991 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_1991 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    llmg_1991 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    llmg_1991 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    llmg_1991 (adhA)
   00626 Naphthalene degradation
    llmg_1991 (adhA)
Enzymes [BR:llm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     llmg_1991 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1978043..1979065)
Genome map
AA seq 340 aa AA seqDB search
MKAAVVRQNPDGYADVVEKELRMIKPNEALLDMEYCGVCHTDLHVAAGDYGNKAGTVLGH
EGIGIVKEIGSEVTSLKVGDRVSVAWFFEGCGHCEYCVSGNETFCREVKNAGYSVDGGMA
EQAIVTADYAVKVPEGLDPIEASSITCAGVTTYKAIKVSGVKPGDWQVIFGAGGLGNLAI
QYAKNFFGAKVIAVDINQDKLDLAKKIGADVIINSGEVNPIDEIKKITGGLGAQSAVVCA
VARIAFEQAVASLKPMGKMVAVALPNTEMTLSVPTVVFDGVEVAGSLVGTRLDLAEAFQF
GAEGKVKPIVATRKLEEINEIIDEMKAGKIEGRMVIDFTK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtagtacggcaaaatccggatggctatgcggatgttgttgaaaaggaa
cttcggatgattaagcccaatgaagctttactcgacatggaatattgtggagtctgtcat
acagacttgcatgtagcagcaggcgattatggcaacaaagctggaacggtccttggtcat
gaaggaatcggtattgtcaaagaaattggtagtgaagtcacttccttaaaagttggagat
cgcgtgtcagtcgcttggtttttcgaaggatgtgggcattgcgaatactgtgtttctggt
aatgaaactttttgtcgagaggtcaaaaatgctggttattcagttgacggtggaatggcc
gaacaagcgattgtaacagctgattatgcggtaaaagttccagagggacttgatcctatt
gaagcaagttcaatcacttgtgctggagttacgacttacaaagcaatcaaggtttctgga
gttaagccaggagattggcaagtcatctttggtgccggtggactaggtaatctagctatt
caatacgctaaaaatttttttggggcaaaagtaattgcagttgatattaatcaagataaa
ttagacttagctaaaaaaattggtgcagatgtgattatcaattctggtgaagtcaatcca
attgatgaaataaaaaaaatcactggtggtttaggagcacaaagtgctgttgtttgcgcc
gttgcaagaatagcatttgaacaagcagtcgcttctttgaaaccaatgggtaaaatggtt
gcggtggcactgcctaataccgaaatgactttgtctgttccgacagttgtttttgatggt
gtggaagttgctggctcacttgttggaacaagacttgatttagcagaagcatttcaattt
ggtgctgaaggtaaagtcaaaccaattgttgcgacacgcaagcttgaagaaatcaatgag
attattgatgaaatgaaagcaggaaaaattgaaggccggatggtcattgattttactaaa
taa

DBGET integrated database retrieval system