KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_2345Help
Entry
llmg_2345         CDS       T00475                                 

Definition
histidinol-phosphate phosphatase
Orthology
K03273  
D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC:3.1.3.82 3.1.3.83]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:llm00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2302378..2302923)
Genome map
AA seq 181 aa AA seqDB search
MRKAIFFDRDGTLNEFKLGDYIIQVEELVLLNGAARAVKKANAAGYLCIIVTNQGGVIHN
RGLAYSDVERINERLVQLLNEEGGKIDGIYVCPHYPGYESCTCRKPKTGLINMAVSDFSI
SLNNSYIIGDSDSDVLAGKNAGLKTVGIGERIKTEADFCTYNVEEAVNYILKRESKCQKS
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaattttcttcgatcgtgatgggacgctcaatgaatttaaactaggagat
tatattatacaagttgaagagcttgtattacttaatggagcagcaagggcagtaaaaaag
gccaatgcagcgggctatttgtgtattattgttaccaatcaaggaggagttattcataac
agaggactcgcttattctgatgttgaaagaataaatgaacgattggtccaacttttgaat
gaggagggtggcaaaattgatggaatttatgtttgtccgcattatcctggctatgagtct
tgtacatgccgtaaacccaaaactggcttgattaatatggctgtgagtgatttcagtatt
agtctgaataattcatatataatcggggattctgattctgatgtcttggctggaaaaaat
gcaggtcttaaaacagtagggataggtgagcgaataaaaaccgaggcagatttttgtact
tataatgttgaagaagcggtgaattatattttgaaaagagagagtaaatgccaaaagtca
gtgtaa

DBGET integrated database retrieval system