KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_2387Help
Entry
llmg_2387         CDS       T00475                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    llmg_2387 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    llmg_2387 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    llmg_2387 (thrC)
Enzymes [BR:llm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     llmg_2387 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2328911..2330401)
Genome map
AA seq 496 aa AA seqDB search
MVTFYQSTRDKSNKKAASQAILQGLAEDGGLFVPVEFPKVDLDFKKLKNASYQEVAELVL
KAFFDDFSADEIKLMVTKAYGEKFDSPEIAPLKNLGNHYILELFHGETIAFKDMALSILP
HLMTQAAKKNGVTNEIIILTATSGDTGKAAMAGFADVPQTKIIVFYPKGGVSHIQEQQML
TQKGANVHVVGIDGNFDQAQTAVKEMFNNKSLHDQLLKNHQQFSSANSMNIGRLIPQVAY
YIYAYAQLVKTGQITDGEKINFSVPTGNFGNILAAYYAKKLGLPVGQLICASNKNNVLTD
FFKTGLYDKNREFYVTSSPSMDILVSSNLERLIFELTDESDDETLTLLTALSAEGHYQIS
KKMMSKLQDFIADWASEEEISKEINETFENENYVLDPHTAVANYVYHQIQPKEKTVVVST
ASPYKFPKVVLEGLQKSGTDLSEKIDDFAAVKSLEKLSGIPLPKAVLGLEKAEILHHTVV
PVQEMQKEVEKYLGLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtaactttttatcaatcaacacgggataaatcaaataaaaaagcagcctcacaagct
atcttgcaaggtttggcagaagacggtggactttttgttcctgttgaatttccaaaagtg
gacttagattttaaaaaattaaaaaatgcttcttatcaggaagttgctgaacttgtatta
aaagcattttttgatgatttttctgctgatgaaataaaattaatggtgacaaaagcctac
ggagaaaaatttgatagtcctgaaattgcaccgctcaaaaatctcgggaatcactatatt
cttgaactctttcatggtgaaactatcgcttttaaagacatggcactttctatcttgcct
catttaatgacccaagcggctaagaaaaatggtgtgaccaatgaaattattattctgacg
gcgacttctggggatacaggaaaagcagctatggcaggttttgctgatgtgccacagaca
aaaattattgttttttatcctaaaggtggagtcagccacattcaagagcaacaaatgctg
acccaaaaaggagctaatgttcacgttgttggaattgatggaaattttgaccaagctcag
acagcagtaaaagaaatgtttaataataaaagcttgcatgaccaacttctgaagaatcat
cagcaattttcatcagcaaattcaatgaatattggacgtttgattccgcaagtcgcttat
tatatttatgcttacgcacaactggtcaaaactgggcaaattactgacggagaaaaaatc
aatttttcagttccgacaggaaattttggaaatattttagccgcttattatgcgaaaaaa
ttgggattaccagttggccagctgatttgtgcctcaaataaaaataatgttttgactgac
tttttcaaaacagggctttatgataaaaatcgagaattttatgtgacaagttcaccgtca
atggatattttggtttcttcaaatcttgagcgtttaatttttgaattaactgacgagagt
gatgatgagactttgactttactgacagctttgtcagcagaaggtcattatcaaatttct
aaaaaaatgatgagtaagttacaagattttatagctgactgggcatcagaagaagaaatt
tccaaagaaattaatgaaacttttgaaaatgaaaactatgttcttgacccccacacagcg
gttgcaaactatgtctatcatcaaattcaaccaaaagaaaaaacagttgttgtcagcact
gccagcccttacaagttccctaaagttgttttagaaggacttcaaaagtcaggaacggac
ttgtcagagaagatagatgattttgctgccgttaaatcacttgaaaaactcagtggtatt
ccattacccaaagctgtgttagggcttgaaaaagctgaaattttgcatcatacagtagtt
ccagttcaggaaatgcaaaaagaagtagagaaataccttggtttaaaatga

DBGET integrated database retrieval system