KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_00355Help
Entry
LLNZ_00355        CDS       T02131                                 

Definition
(GenBank) pyruvate dehydrogenase complex E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00010  Glycolysis / Gluconeogenesis
lln00020  Citrate cycle (TCA cycle)
lln00620  Pyruvate metabolism
lln01100  Metabolic pathways
lln01110  Biosynthesis of secondary metabolites
lln01120  Microbial metabolism in diverse environments
lln01130  Biosynthesis of antibiotics
lln01200  Carbon metabolism
Module
lln_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLNZ_00355
   00020 Citrate cycle (TCA cycle)
    LLNZ_00355
   00620 Pyruvate metabolism
    LLNZ_00355
Enzymes [BR:lln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LLNZ_00355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N E3_binding GCV_H ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ADJ59091
Position
complement(66910..68502)
Genome map
AA seq 530 aa AA seqDB search
MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPIAEVQNDKLMQEILSPYSGTVTKLF
VEEGTTVEVDSPLVEFDGDGSGTSAAAPAPAAQETVSSDAPSGNAQIFTMPDIGEGMHEG
DIANWLVKVGDEIKEDDPVAEVQNDKLMQEILSPYSGKVTKLFVEAGTTVEVGAPLIEYN
GNGESTSNPAPAASPAPIAEAPKAAAAPTDAPLTKTTSTGHILAMPSVRHYARKAGIDLT
QVPATGRHGHTTLADVKAFESGSVAPIAPVAPESAPVAPAPKADKATEKAPTVKSVAGDR
REAMNPTRKVVSKVMTAQHTHIPPVTNFDQVEVSKLVKHRAVFKEVAAKQDIKLTYLAYV
AKALATTAHKFPEINASVDYDKQEIVYHEHVNLGIAVNAPTGLYVPVIHEAETKSILEIA
KEIAELATATREGTLKPQQMQGSTITISNIGSARGSWFTPIINGSDVVILGLGSIVKEPI
VNGEGEIVVGQNMKLSMTYDHRLIDGMLGQTSLNYLKSLLADPEFMLMEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaaaatgcctgatattggcgaaggaatgcacgaaggggacattgcc
aactggttagttaaagttggagatgttgttaaagaagatgatccaattgctgaagtacaa
aatgataaactcatgcaagaaattctctctccctactctgggactgtaacaaaactcttc
gttgaagaaggaacaactgtagaagttgattctcctttggttgagtttgatggagacggg
tcaggaacttctgcagctgctcctgctcctgccgctcaagaaacagtaagttctgatgct
ccttctggcaatgctcaaatcttcaccatgcctgatattggtgaaggaatgcatgaaggc
gatattgccaactggctcgttaaagttggagatgaaattaaagaagatgatcctgttgca
gaggttcaaaacgataaactcatgcaagagattctttctccttactctggaaaagtcact
aaacttttcgtcgaagcaggaacaactgtagaagttggggcccctttgattgaatacaat
ggaaatggtgaatctacaagtaatcctgctcctgctgctagtcctgctccaattgcggaa
gctcctaaagcagccgctgcacctactgatgcgccattgacaaaaacaacttctactgga
catattcttgctatgccatctgtccgtcattatgctcgtaaagcgggaattgatttaact
caagtacctgcaactggtcgtcatgggcatacaactttggctgacgttaaagcttttgaa
tctggtagcgttgcaccaatcgctcctgtggctccagaatcagctcctgtggcacctgcg
cctaaagccgataaagctacggaaaaagccccaactgttaaatctgtggctggagatcgt
cgtgaagcaatgaatccaactcgtaaagttgtttctaaagttatgactgctcaacacact
catattccaccagtaacaaactttgatcaagtggaagtttctaaacttgttaaacatcgc
gccgtctttaaagaagtagcagcaaaacaagatatcaaattgacttaccttgcttatgtt
gctaaagccttggcaactactgctcataagttcccagaaattaatgcttctgttgactat
gataagcaagaaattgtttatcatgaacatgtcaaccttgggattgctgtaaatgcccca
actggtttatatgtcccagtcattcatgaagctgaaactaaatcaattcttgaaattgca
aaagaaattgctgaattagcgactgctacacgtgaaggaacacttaaacctcaacaaatg
caaggttcaacgattacaatttcaaatattggttctgctcgtggttcttggtttacacca
atcatcaacggttctgatgttgtgattttaggtttgggttcaattgttaaagaaccaatt
gtcaatggtgaaggtgaaattgtcgtaggacaaaacatgaaattgtctatgacttatgac
caccgtttgattgatggtatgttgggtcaaacatcacttaactacttgaaatcacttttg
gctgaccctgagttcatgcttatggaaatttaa

DBGET integrated database retrieval system