KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_00830Help
Entry
LLNZ_00830        CDS       T02131                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LLNZ_00830
Enzymes [BR:lln01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     LLNZ_00830
Exosome [BR:lln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LLNZ_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(148498..150441)
Genome map
AA seq 647 aa AA seqDB search
MPLNILDYDPYLEPFKDDLSLRLFEFARTKKRLLGVDGSLVDFANGYKYFGFQQESKHWT
FREWAPNAKKAWLVGDFNNWENNYELKQAYGGTWEISVPGLLPVGSKVKIKLLLPTGEVV
YRVPSYIMYALPNENHGLDGVITQPKYEWKNKSPKLSEAPLIYEAHIGISTEEYKINSYK
EFTRDVLPRIKKDGYNTIQLMAIMEHPLYASFGYQVSNFFAISSRFGQPEDLMELIDKAH
GLGLQVLLDVVHSHAVKNIEDGLNYFDGTENQYFHEGERGNHPAWKTKLFNYGKDEVLHF
LLSNLKFWLDIYHFDGFRFDGVTSMLYHDHGLGTAFTDYSKYFSLNTDVEAVTYLMLANE
LTHLFNPSATTIAEDMSAMPGMALPISAGGIGFDYRLSMGIPDFWIKQLKEKTDNSLDLL
SLWWELTTRRPGEKNIGYSESHDQALVGDKTLMMWLANEEIYWNMDINSQSLIIDRAIAL
HKLIRLITFSLAGEGYLNFMGNEFGHPEWLDFPREENHDDFQHARRQWSLADNENLRFKY
LLAFDQAMLNLEHDFKFLESTDPVQQLWIKDSDKLLAYKKGQLVFVFNFHPSYEQKLQLQ
FSKKPELIFDSDDQKFGGFGPRSSFGWSKGTLNLILEPRTAMVFKIK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaatatcttggattatgacccctatttggaacctttcaaagatgacttgtct
ttacgcctctttgaatttgctagaactaagaaacggcttttgggcgttgatggttcttta
gttgattttgcgaacggctataagtattttggcttccaacaagaaagtaaacactggact
ttccgcgaatgggcaccaaatgctaaaaaagcttggcttgttggtgactttaacaattgg
gaaaacaactatgaactaaaacaggcttatggcgggacttgggaaatttcagttcctgga
ttattacctgtgggttctaaagtaaaaataaagttgcttttgccaactggagaagttgtt
tatcgtgttccttcttacattatgtatgctcttcctaatgaaaatcatggtttagacggg
gttattactcagcctaagtacgaatggaaaaataaaagccctaaactaagcgaagcacct
ttgatttatgaagcacatattgggatttcaaccgaagaatacaaaattaattcttacaaa
gaattcacgcgcgatgttttacccagaattaaaaaagatggttacaataccattcagctg
atggcaattatggaacacccgctctatgctagttttggttatcaagtttccaattttttt
gccatctctagtcgctttggtcagccagaagatttaatggaattgattgataaagcacat
ggtttgggtttgcaagtgcttttagacgtggttcattcacatgctgtaaaaaatattgag
gatgggctcaactattttgatggaacagaaaatcagtattttcatgaaggcgaacgggga
aatcatccagcttggaagacgaaactttttaattatggcaaagatgaagtccttcatttt
ttactatcaaatctaaaattttggctagacatttatcatttcgatggctttcgttttgat
ggagtaacttcaatgctttatcatgaccatggtttaggaactgcttttacagattatagt
aagtatttttcacttaatacagatgttgaagccgtgacatatttgatgctggctaatgaa
ctaactcatctctttaatccatcagcaacaacaatcgccgaagacatgtctgccatgcct
gggatggcactacctatctcggctggcggaattggttttgattatcgtttgtcaatggga
attcctgatttttggattaaacaattgaaagaaaaaacagataatagtttagatttgcta
agtttatggtgggaattgacgaccagacgacctggagagaaaaatatcggttattcagaa
agtcatgaccaagctttagttggtgataaaacactgatgatgtggctagctaatgaagaa
atctattggaacatggacatcaatagtcaatctctgattattgaccgcgccattgccctc
cataagttaattcgattgattactttcagtctagcaggtgaaggttatttaaatttcatg
ggaaacgaatttggtcatcctgaatggcttgacttccctcgagaagaaaatcatgatgat
tttcaacatgctagaagacaatggtcacttgctgataacgaaaatttacgtttcaaatat
ttactggcatttgaccaagccatgctcaatttagaacatgatttcaaatttttagaaagt
acagatcctgtccaacagctttggattaaggattcggataaattactggcatacaaaaaa
ggacaattagtttttgtctttaatttccaccctagttatgagcaaaaacttcagctccaa
ttttctaaaaaaccagaacttatctttgacagtgatgatcaaaaattcgggggatttggt
cctagaagtagttttggttggtcaaaaggaactttaaatttgattcttgaacctagaaca
gcgatggtatttaaaattaaataa

DBGET integrated database retrieval system