KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_00990Help
Entry
LLNZ_00990        CDS       T02131                                 

Definition
Beta-glucosidase A
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLNZ_00990
Enzymes [BR:lln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LLNZ_00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
178257..179693
Genome map
AA seq 478 aa AA seqDB search
MEHKKLSSFPSDFLWGSASAAYQVEGAPFEDGKKASVWDNFVRIPGKTFKGTNGDVAVDH
YHRYKEDVALMKELGLKSYRFSIAWTRILPDGRGEVNQAGLKFYEDLIDELIANHIEPIV
TIYHWDLPQALEDLYGGWESREIISDFVNYAEVLFKAFKGKVKYWVSLNEQNIFTSQGWS
LATHPPGKRDMKLFYQVNHIANLANAAVINKFHELEMDGQIGPSFAYTPQYAKDSDPLNV
LAAENAEELYSHFWMDVYLYGEYPIAAMAYLRENGLAPEFEAGDAELLKSAKPDFLGINY
YQTATNAWNPIDGGVGVGSFNTSGKKGTTKESGIPGLHKKIQNPFIDRTNWDWEIDPEGL
RIALRRITSRYRIPVMITENGLGEYDKVEEGKIHDDYRIKYLESHVKAIKEAMTDGATVI
GYHTWSYTDLLSWLNGYQKRYGFVYVDQDETMEGSLKRIPKDSYYWYQHLIETNGEEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaaaaaattgagctcatttccaagtgattttctttggggttcagcttcagca
gcttatcaagttgaaggagcaccttttgaagatggtaaaaaagcgagtgtctgggataac
tttgtccgcattccgggtaaaacttttaaagggacaaacggggatgttgctgttgatcat
taccatcgttacaaagaagatgtcgctttgatgaaagaattaggacttaaatcctaccgt
ttttcgattgcttggacacgtattttacctgacggacgtggcgaagtcaatcaagcgggc
ttgaaattctatgaagacttgattgatgagttgattgctaatcatattgaaccaattgtc
acgatttatcattgggacttgccccaagctttagaagacctgtatggcggctgggaatca
cgagaaattatctcagattttgttaactatgctgaagttttgtttaaagcctttaaaggt
aaagtaaaatattgggtatcgcttaatgaacaaaatatctttacaagtcaaggttggtca
ctcgcgactcacccaccagggaaaagagatatgaagctcttttatcaggtcaatcatatc
gcgaatttggcaaatgctgcggtaattaataagtttcatgagcttgaaatggatggacaa
attggcccttcattcgcctatacaccgcagtatgctaaggattctgaccctttaaatgtt
ttggctgctgagaacgctgaagaactttatagccacttttggatggatgtttacctttat
ggtgaatacccaattgcggcaatggcttatctgcgggaaaatggtttagcacctgaattt
gaagcaggagatgctgaactcttgaagtcggccaaacctgattttctaggcattaattac
taccaaacggcgactaacgcttggaatccaattgatggtggggttggagttggttcattt
aatacaagcggtaaaaaaggaacaaccaaagaatcaggaattcctgggcttcataaaaaa
attcaaaatccattcattgaccgcacaaattgggattgggaaattgacccagaaggtttg
cgaattgcactccgtcgaattacttcacgctatcgtattccggtcatgattacggaaaat
ggtttgggtgaatatgacaaagttgaagagggcaaaattcatgatgattaccgaattaaa
tacctagaaagtcatgttaaggcaatcaaagaagccatgactgacggtgctacggtcatt
ggttatcacacttggtcttatactgacttactttcatggttgaacggttatcaaaaacgt
tatggttttgtttatgttgaccaagacgaaacaatggaaggttccttaaaacgaattcct
aaggattcttattactggtatcaacatcttattgaaacaaatggcgaagagctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system