KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_01080Help
Entry
LLNZ_01080        CDS       T02131                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LLNZ_01080
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LLNZ_01080
Enzymes [BR:lln01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LLNZ_01080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
196330..196923
Genome map
AA seq 197 aa AA seqDB search
MTENFFGKTLASREISQIPGMLEFDIPVHGDNRGWFKENFQKEKMMPLGFPESFFAEEKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGSVLGAWVDLREGENFGHVYQTVIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPTLGIKWEDVENAEVSEAD
KNHPMLKDVKPLKADEL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaattttttcggaaaaacacttgctagtcgagaaattagtcaaattccagga
atgttagaatttgatattccggttcatggtgataatcgtggttggtttaaagaaaatttt
caaaaagaaaaaatgatgcctcttggttttccagaaagtttttttgctgaagaaaaattg
caaaataatgtaagtttctctcgtaaaaatgttttgcgtgggcttcatgccgaaccttgg
gataaatatatttctgttgctgatggtggctctgttttgggtgcatgggttgatttacgc
gaaggcgaaaattttggtcatgtttaccaaacagtcattgatgcaagtaaaggaattttc
gttccacgcggcgtggctaatggtttccaagttttatctgatacagtttcttatagctat
ctggttaatgattactgggcacttgaacttaaacctaaatatgcttttgtaaactacgct
gacccaacattgggaatcaagtgggaagatgttgaaaatgctgaagtttctgaagcagat
aaaaatcatccaatgttaaaagatgtaaaacctttaaaggctgatgaactctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system