KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_01385Help
Entry
LLNZ_01385        CDS       T02131                                 

Definition
(GenBank) fructose-1,6-bisphosphatase class 3
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00010  Glycolysis / Gluconeogenesis
lln00030  Pentose phosphate pathway
lln00051  Fructose and mannose metabolism
lln00680  Methane metabolism
lln01100  Metabolic pathways
lln01110  Biosynthesis of secondary metabolites
lln01120  Microbial metabolism in diverse environments
lln01130  Biosynthesis of antibiotics
lln01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLNZ_01385
   00030 Pentose phosphate pathway
    LLNZ_01385
   00051 Fructose and mannose metabolism
    LLNZ_01385
  Energy metabolism
   00680 Methane metabolism
    LLNZ_01385
Enzymes [BR:lln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LLNZ_01385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ADJ59285
Position
250909..252831
Genome map
AA seq 640 aa AA seqDB search
MDKKYYQLLKKQFSSKEAVLTEIINLSAICELPKATEHFMSDVHGEYDAFNHVLRNGSGS
IKEKLRDCFPQFSSAEISSVATLIYYPQEKLDSECQLQDKKLFEHYCRLNLVYLLKTVKF
VGQKYTRSKVRKAFPEKFRYILEELINEVDSTTDKQDYFDSILSQLQNLGELTRLIVALA
DTIRRLTVDHLHVVGDIYDRGPYPDKIIDRLINMPSVDVQWGNHDIVWMAAFSGSPLAMM
NVIRICARYGNLDILEESYGINLRAILEYAERYYEPSEAFRPRLVDGVRLSADEKALLNK
LQQTTAILQFKLESQLIERRPDFQLEHRDLLHFIDFSQNKIELAGETYDLIDFQAPTINP
EQPASLTEEEEKIIAHLLNNFKTSDKLKRHVGFLQEKGAMYLSYNGNLLIHGCLPLHENG
DFKSFTIDKKAYAGRDLLDFFDSEVRKCLAHPEESEDLATDLMWYLWVGECSSLFGKTAM
TTFERYYIKDKSTHVEKKNPYYQLREQPKIITKILENFGLDENGHLVNGHTPIKEKNGEN
PIKADGKLIVIDGGFAKAYQKETGIAGYTLLYNSFGIQLVAHQPFSTVKAAVEKGTDIIS
LKRLVAEVDERKRVKDTNVGQTLLSEIADLEVLFEHYEDY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaatattatcagttattaaaaaagcagttttcttcaaaggaggctgtactt
acagaaattattaatttgagtgcaatttgtgaattaccaaaagcaacagagcattttatg
agtgatgtgcatggtgaatatgatgcttttaatcatgtcctaagaaatggttctggcagt
atcaaagaaaaattacgggattgttttccacaattttcgtcagcagaaatttcatcagtg
gcaaccttgatttattatccacaagagaaactagactctgaatgtcaacttcaagataaa
aagctttttgagcactattgccgtctaaacctagtctatctattgaaaacagttaaattt
gttggacaaaaatatacgcgttcaaaagttcgtaaagcttttccagaaaaatttcgctac
atcttagaagagttaatcaatgaagtggattcgacgactgataaacaggattattttgat
tcaattctttcgcaactacaaaatctgggagaacttactcgcttaattgttgcacttgca
gatacaattcgcagattgacggtcgaccatctacatgttgttggggatatttatgaccgc
ggaccatatccagacaaaattattgaccgtttgataaacatgccctcagttgatgttcag
tggggcaatcatgatattgtgtggatggcggcttttagtggctcacctttggccatgatg
aatgtgataagaatttgcgcccgttacgggaatttagatattcttgaagaatcttatggg
attaatttgcgtgcgattttagaatacgctgaacgttattatgaaccaagtgaggcattt
cgtccccgtttagttgatggggttcgcttgtcagctgatgaaaaagcactgcttaataaa
ttacagcaaaccacggctattttacaatttaagttagaaagtcaactaattgaaagacgg
ccagatttccaacttgaacatcgggacctcctccattttattgatttctcacaaaataaa
atagaattagcaggtgaaacttatgatttaattgattttcaggcgcctacaattaatcct
gaacagcccgcaagtctaactgaggaagaagaaaaaataattgctcacttgttaaataat
tttaaaacttcagataagctcaagcgccatgttggattcttgcaagaaaaaggggccatg
tatctttcttacaatggcaatctattgattcatggttgccttcccttacatgaaaatgga
gattttaaatcatttacgattgataagaaggcttatgctggacgagatttacttgatttt
tttgacagtgaggttagaaaatgtcttgctcatcctgaagaatcagaggatttagcaaca
gatttgatgtggtacttatgggtgggagaatgttcttccttgtttggcaaaacagcaatg
acaacctttgaacgttattatatcaaggataaatctactcatgtagaaaagaaaaatcca
tattatcaattacgtgaacaacctaaaatcattacaaaaatcttagaaaactttggttta
gatgaaaatggacatttggttaatggtcacactccaattaaggaaaaaaatggcgagaat
ccaatcaaggcggatggaaagttgattgtgattgatggaggttttgctaaagcctatcaa
aaagaaacaggtatcgctggatatactcttctttacaatagttttggcattcaattggtt
gctcaccaacctttttcgacagtcaaagcagcggtcgaaaaaggaacagatattattagc
ttgaaacgtttagtggcggaagttgacgaacgaaagcgggtcaaagatactaatgttggg
caaactttgctaagtgaaatagcagatttagaggtgctttttgagcattatgaagattat
taa

DBGET integrated database retrieval system