KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_01860Help
Entry
LLNZ_01860        CDS       T02131                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLNZ_01860 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LLNZ_01860 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLNZ_01860 (gpmA)
Enzymes [BR:lln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LLNZ_01860 (gpmA)
Membrane trafficking [BR:lln04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LLNZ_01860 (gpmA)
Exosome [BR:lln04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LLNZ_01860 (gpmA)
  Exosomal proteins of melanoma cells
   LLNZ_01860 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
342206..342907
Genome map
AA seq 233 aa AA seqDB search
MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKEAGIEFDIAYTSVLKR
AIKTTNLALEFSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVL
PPAMDHDDKYTAHGDRRYAGLEDSLIPDAENLKVTLERALPFWEDQIAPALKEGKNVFVG
AHGNSIRALVKQIKKLSDDEIMDVEIPNFPPLVFEFDDNLNVQNEYYLAPKKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagtatttgcacgtcacggtgaatctgaatggaatcttgctaaccttttc
acaggttgggctgacgttgacctttctgaaaacggaactaaacaagcgattgaagctggt
aaattgattaaagaagctggaatcgaatttgatattgcatacacttcagtattgaaacgt
gcgatcaaaacaactaaccttgctcttgaattttcagatcaactttgggtaccagttgtt
aaatcatggcgcttgaacgaacgtcactacggtggtttgacaggtttgaacaaagctgac
gctgctgcaaaacatggtgatgaacaagttcacatctggcgtcgttcatatgatgtattg
ccacctgcaatggatcatgatgataaatatacagctcacggagaccgtcgttatgctggt
cttgaagattcattgattcctgatgctgaaaacctcaaagttactttggaacgcgctctt
ccattctgggaagaccaaatcgctccagctttgaaagaaggaaaaaatgtcttcgttggt
gctcacggtaactcaattcgcgccctcgttaaacaaatcaaaaaactttctgatgacgaa
attatggatgttgaaatccctaacttcccaccacttgttttcgaatttgatgacaatttg
aacgttcaaaacgaatactatttggctccaaaaaaagcttaa

DBGET integrated database retrieval system