KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_01880Help
Entry
LLNZ_01880        CDS       T02131                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lln00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LLNZ_01880 (recR)
DNA repair and recombination proteins [BR:lln03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     LLNZ_01880 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LLNZ_01880 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_8 HHH_5 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: ADJ59380
Position
347730..348326
Genome map
AA seq 198 aa AA seqDB search
MYYPEPIARLIESFSKLPGIGQKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLRFCSIC
GNLTESDPCAICTDPTRDRTTILVVEESKDVLAMEKIREYRGLYHVLHGTISPMNGISPD
EINVKSLITRLMDSEVKEVIIATNATSDGEATAMYLARMIKPAGIKVTRLARGLAVGSDI
EYADEVTLSKAVENRLEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatccagaacctattgctcgcctgattgagtcattttcaaaattacccggaatt
gggcagaaaacggcgacacggctagctttttatacgattggcatggaagatcaagatgtc
aatgaatttgcgaaaaatctcttgtcagcaaaacgagatttacgcttttgctctatttgt
gggaatttaacagaaagtgatccttgtgctatttgtactgatcccacacgtgatagaaca
acgatattggttgtcgaagaatctaaagatgttcttgccatggaaaaaatccgtgaatat
cgcggactctatcatgtcttacatggaacaattagtccaatgaacgggatctctcctgat
gaaattaatgttaaatctttgattacaaggttaatggactcagaagttaaagaagtgatt
attgcgaccaatgcaacttcggatggtgaagcaaccgctatgtatctggctcgaatgatt
aaacctgcgggaattaaagtgacacgactggctcgtggattagctgtagggtctgatata
gaatacgctgatgaggttaccttatcaaaagccgtggagaatcggttggaaatttga

DBGET integrated database retrieval system