KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_01945Help
Entry
LLNZ_01945        CDS       T02131                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LLNZ_01945 (asnB)
Enzymes [BR:lln01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LLNZ_01945 (asnB)
Peptidases [BR:lln01002]
 Cysteine Peptidases
  Family C44
   LLNZ_01945 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
364549..366123
Genome map
AA seq 524 aa AA seqDB search
METSDLTIEEFKSNLELIEHRGPDDQQHVRDTLGNDFGFCRLSIMDLSDLGRQPFGLNGK
RVMCNGEIYNFLSLRKFLETKGYKFTGDSDCEVLLPLFETTGIETMVKMLDAEFAFVLVD
ENTGEIFAARDPFGIRPLFYGYNKVTGKISFSSEAKALISTCKDVTPFPPGYYYAGGEFH
VYNDIAEVSTIVEEPLAEISGHIRRKLERAVKKRLHADAPMGYLLSGGLDSSLVCAIAAK
ELESPIKTFAIGMETDPIDLKYAREVADFLRTDHTEILMTKEDVLSAVREVIWHLETWDI
TTIRASIGMYLICKYIHENTELKVLMTGEVSDEMFGYKYTDFAPSAGAFQKEAQKRVHEL
YMYDVLRADRCLAAHSLEARVPFADLDFATYVMSINPSRKLNTYGKGKYLLRHAFEGTEL
LPDEILFREKAAFSDAVGHSMVDYLKEFADEKYSDEDLAKASEKYPKHTPFTKESLMYRE
IFEEFYPGYEDWILDFWMPNRDWVGAEVTDPSARVLSNYGDSGK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatctgacttaacgatagaagagtttaaaagcaatttggaactgattgaacat
cgaggaccagacgaccaacaacatgttcgtgatactttgggaaatgattttggtttttgc
cgactttcaatcatggatttgtcagacttggggcgtcagccctttggactgaacgggaaa
agagttatgtgtaatggtgaaatttataactttttaagccttcgtaagttcttggaaact
aagggatataaatttacaggagattctgattgtgaagtgcttttacctctttttgaaacc
acaggaatcgaaacaatggtcaaaatgcttgatgctgaatttgcttttgtactagttgat
gaaaatactggtgaaatttttgccgctcgtgatccttttggaattcgtccacttttttat
ggttataataaagttacggggaaaatttctttctcttctgaagctaaggcccttatttca
acctgtaaagatgtgacgccttttccaccaggttattattatgcaggtggtgaatttcat
gtttataatgatattgcggaagtttcaacgattgttgaagaacctttggctgaaatttca
ggacatatccgtcgcaaattggaacgtgcagttaaaaaacgtcttcatgcagatgctcca
atgggttatctcttgtcaggcggtttagattcatcattggtctgtgccattgcagctaaa
gaattagaaagtccaatcaagacctttgcgattggaatggaaacagacccgattgatttg
aaatatgctcgggaagtagcagatttcttacggactgaccataccgaaattttgatgaca
aaagaagacgtactttcagcagttcgtgaagtgatttggcatttggaaacttgggatatc
acgacgattcgggcttctattgggatgtatttaatctgtaagtatattcatgagaataca
gagctgaaagttttgatgaccggtgaggtttccgatgaaatgttcggctataaatatact
gactttgctccatcagctggggcctttcaaaaagaagcccaaaaacgagtgcatgaactt
tatatgtatgatgtcctgcgggctgaccgctgtttagcggctcattctcttgaagcgcgt
gttccatttgctgacttggattttgcgacttatgtcatgtccatcaatcccagcagaaag
ctgaatacttatggcaaaggaaaatatctcttgcgtcatgcttttgaaggaacggagcta
ttaccagacgagattttatttagagaaaaagcggctttttctgatgctgttggtcattcc
atggtcgactatttaaaagaatttgctgacgaaaaatattctgatgaagatttagcaaag
gccagtgaaaagtatccaaaacatacaccatttaccaaagaatccttgatgtatcgggaa
atttttgaagaattttatccaggatatgaagattggattcttgatttttggatgccaaat
cgcgattgggttggggcagaagttactgacccatcagctcgcgtcttatcaaattatggt
gattctggaaaataa

DBGET integrated database retrieval system