KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_01950Help
Entry
LLNZ_01950        CDS       T02131                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lln03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
366315..367133
Genome map
AA seq 272 aa AA seqDB search
MPELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYL
IFEIGDDFRLISHLRMEGKYRLATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELIST
DQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLW
LAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQVYG
KTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgaaaccgttagaagagaacttgaaaaaagaattgttgga
caaaaaattatatctatagaagccacttatccaagaatggtcttaaccggttttgagcaa
ttgaaaaaagaattgacaggaaaaaccattcagggcatctcgcggcgaggaaaatattta
atttttgaaattggagatgactttcgcttgatttctcatttacgaatggaaggaaaatat
cgcttagcaacacttgatgcaccaagagaaaagcatgaccatttgacaatgaaatttgct
gatgggcagttaatctatgccgatgtaaggaaatttggaacttgggaattgatttctact
gaccaagtgcttccctattttctgaagaaaaaaattggaccagaaccgacctatgaagat
tttgatgaaaagctttttcgagagaaattaagaaaatcaacaaagaaaataaaaccttat
ttacttgaacaaacccttgttgctgggcttggtaatatttatgttgatgaagtgctctgg
ttagcaaaaattcatccagaaaaagagactaatcagctgatagaaagttccatccacctt
ttgcacgactcaattattgaaattttgcaaaaagcgattaagcttggtggttcaagtatt
agaacttatagtgccttaggatcaaccggtaaaatgcaaaatgagttgcaagtttatgga
aaaacgggtgaaaaatgttcccgttgtggtgcagaaattcaaaaaataaaagttgctggt
cgaggcactcatttttgcccagtttgtcagcaaaaataa

DBGET integrated database retrieval system