KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_02555Help
Entry
LLNZ_02555        CDS       T02131                                 

Definition
putative beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LLNZ_02555
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LLNZ_02555
Enzymes [BR:lln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LLNZ_02555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489116..490336
Genome map
AA seq 406 aa AA seqDB search
MTKRLKKQAKPVVFLGLVIGCALIVSGVLGLSGHLNNQEAIKSKKKNQVSETKTNSSSQN
KSDPKMPKMPKMTLEQKVGQLFMTGMPANNYDQATFDAIEKYQVGSIILTGRSNLSIPEM
KDITDKLQGLAPANRRLLISCDQEGGNVQVLQGAGFSEMPNGLTQGSWAPEKLQEEAKNW
GSELSAAGINFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKANIVSHADAFSKGMKSA
GVLTTAKHFPGLGAVTGNTDISAGVRDGQTNPKSESVQIFKELISSGVPSIMTATAIYDQ
IDLELPGAFSPKMVDGLLRNQLDFDGLVITDDLSNAVQVQAWSPGQRAVLALAAGNDLVL
ANEPTQIPEMISEVLQKAKSDQEFAEKINQASSRVMKVKEQMKLVE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaaagattaaagaaacaagcaaaaccagtcgtttttctaggccttgttattggt
tgtgcacttattgtgtcaggagttcttggtctgtcaggacatttaaataatcaagaagca
atcaaaagcaaaaagaaaaatcaagtttcagaaacaaaaactaattcaagtagtcaaaat
aaaagtgacccaaaaatgccaaaaatgccaaaaatgactttagaacaaaaagtgggtcag
ttatttatgacggggatgcctgcaaataactatgaccaagcaacttttgatgcgattgaa
aaatatcaggttgggagtatcattttgacgggccgctctaatctcagtattcctgaaatg
aaagatattactgacaagctacaaggcttagcacctgctaatcgacgtcttttgatttct
tgtgatcaagagggaggaaatgttcaggttcttcaaggggctggtttttcagaaatgcct
aatggattgacccaaggaagttgggcgccagaaaaattacaagaagaagctaaaaattgg
gggagtgaactttcagccgctggaatcaattttgatttagccccagttgctgaccaggta
ttatctgctgattttgcaccacaaaatgctccgattggctactggagtcgtcagtatgct
tatgacaaagctaatattgtcagtcatgctgatgctttttctaaaggaatgaaatcagct
ggtgttttaacaaccgctaagcattttccagggcttggagcggtgacaggtaacacggat
atcagtgctggtgttagagatgggcaaacaaatcctaaaagtgaatccgttcagattttt
aaagaattaatttcttcgggagttccatcaattatgacggcgacagcaatttatgatcaa
attgaccttgagcttccgggagccttctcacctaaaatggttgatggcttactccgaaat
caattagactttgatggtttggtaattactgacgatttatcaaacgctgttcaagttcaa
gcttggtcaccaggccaaagagcagtattggcgctggcagcgggaaatgaccttgtccta
gccaatgagcccactcaaattccagaaatgatttcagaagttttgcaaaaagcaaaatct
gatcaggaatttgcagaaaaaattaatcaagcatcatcaagggtgatgaaagtaaaagaa
caaatgaaacttgtagaatag

DBGET integrated database retrieval system