KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_02670Help
Entry
LLNZ_02670        CDS       T02131                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LLNZ_02670
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LLNZ_02670
Enzymes [BR:lln01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LLNZ_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
508919..510199
Genome map
AA seq 426 aa AA seqDB search
MDKIIVKGGQTKLQGEVEIEGAKNAVLPLLAATLLASEGEVVLTNVPILSDVFMMNNLVD
HLGTSISFDQEAKKIIAKANSEIKTTAPYEYVSKMRASIVVMGPILARNGQARVSMPGGC
SIGSRPIDLHLRGFEQMGATITQNAGYIEAKADKLKGAHIYLDFPSVGATQNLILAATLA
EGVTTLENAAREPEIVDLANLLNKMGANVKGAGTDTIIIKGVEKMHGAKHSVVQDRIEAG
TFMVAAAMTQGDVLIKDAIAEHNRPLISKLSEMGVNFTQEETGLRVVGPEKLKATSVKTL
PHPGFPTDMQSQMTAAQAIAAGESVMVETVFENRFQHLEEMRRMGLEVDITRNTALIQGN
SNLQGAAVKSTDLRASAALILLGLVAKGQTTVRRLSHLDRGYYKFHEKLKALGADIVRVK
DEDGEE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggataaaataattgtaaaaggtgggcaaacaaaacttcaaggagaagtcgaaattgaa
ggagcaaaaaatgctgttcttccacttcttgccgctactttacttgctagtgaaggcgaa
gttgtattaactaatgtccctattttaagtgatgtttttatgatgaataatttagtagat
catctagggacgagcattagttttgaccaggaagcaaagaaaatcattgctaaagctaat
tctgaaataaaaacaactgccccttatgagtatgtcagcaaaatgcgagcatctattgtt
gtcatgggaccaattttagctagaaatggccaagcgcgggtttctatgccaggaggatgt
tcaattggttcacgtccaatcgatttacatttgcgtggatttgagcaaatgggagcaaca
attactcaaaatgctggttatattgaagctaaggctgataaattaaaaggagctcacata
tatcttgatttcccttcagtaggagccacgcaaaatctaattcttgcggctaccttagcc
gaaggagtaacaacactcgaaaatgcggcccgcgaaccagaaatcgttgacttagccaat
cttttgaacaaaatgggtgcaaatgttaagggcgctgggactgatacaatcataatcaaa
ggtgttgaaaaaatgcacggtgcaaaacactctgttgttcaagatcgaattgaagccgga
actttcatggttgcagcagcaatgacccaaggtgatgtactaattaaagatgcaattgct
gagcataatcgtccattaatatcaaaactcagtgaaatgggcgttaatttcactcaagaa
gaaacaggacttagagtcgtagggcctgaaaaactcaaagctactagtgttaaaacattg
ccacacccaggttttccaactgatatgcaatctcaaatgaccgccgctcaagcgatcgca
gctggagaatctgtaatggtcgaaacagtatttgaaaatcggttccaacatttagaagaa
atgcgtcgtatgggattggaagtagatattactagaaatacagccttaatccaaggaaat
tcaaatttgcaaggagccgcagtaaaatcaacagatttaagagcgagtgcagctttgatt
cttttaggattagtggctaaaggccaaacaactgtaagaagattaagtcacttagaccgc
ggttattataaattccatgaaaaattaaaagcacttggtgctgatattgtccgagtgaaa
gatgaagacggagaagaataa

DBGET integrated database retrieval system