KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_04070Help
Entry
LLNZ_04070        CDS       T02131                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LLNZ_04070
Enzymes [BR:lln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LLNZ_04070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
774923..775843
Genome map
AA seq 306 aa AA seqDB search
MTKVSVVGSISMDLVTSTKRVPQAGETVFGENFAMVPGGKGANQAVAFARLAPRDVNMIG
AVGNDAFGETILKNFKENAVLFDDVGTVPQTTGIAQITLFDDDNRIIIIPGANNEVLPDY
LENFWEKIKDSQLVVLQNEIPHETNLAVAKFCKENAIKVLYNPAPARKTDLEMIEFVDYI
TPNEHECKELFPNEFLEEILAKYANRLIVTLGSEGVIFHDGNEVQKIPAIKAKVVDTTGA
GDTFNGAFAFGLTENLSIADSIQLAVVASHLSIHKFGAQGGIPSLAEVEDKLKELNLNFY
KEKKGL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtaagtgttgtaggaagtatttccatggatttagtgacaagcacaaaaaga
gttccacaagcaggtgaaacagtttttggagaaaattttgcgatggttcctggtggcaag
ggagcaaatcaagccgttgcttttgctagattagctcctcgtgatgtaaatatgattgga
gcagttggaaatgatgcttttggagaaactattctaaaaaacttcaaagaaaatgctgtt
ctttttgacgatgtgggaacggtaccacaaacgacagggattgcccaaattaccttattt
gatgacgataatcgaattatcattattcctggggccaataatgaagtccttcctgattat
ttagagaatttctgggagaaaattaaagacagtcaacttgtggtcttacaaaatgaaata
ccacatgaaactaaccttgcagttgctaaattttgtaaagaaaatgcgataaaagtcctt
tataatccagctccagcaagaaaaacggatttagaaatgattgaatttgtagattacatc
acgcccaatgaacacgaatgtaaggagctttttccgaatgagtttctggaggaaattctt
gctaaatatgcgaatcgcctgattgtcactttaggaagtgaaggagtgattttccatgat
ggtaatgaggttcaaaaaattccagcaattaaagctaaagtggtagatacgacgggagca
ggggatacattcaatggagcttttgcttttggactgaccgaaaatctatcaatcgctgat
tctatccaattggcagtggttgcttcccatttatctattcataaatttggtgctcaaggt
ggaattccaagtctagcagaagttgaagataaattaaaagagcttaatcttaatttttat
aaggaaaagaaaggactttga

DBGET integrated database retrieval system