KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_04555Help
Entry
LLNZ_04555        CDS       T02131                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00330  Arginine and proline metabolism
lln00332  Carbapenem biosynthesis
lln01100  Metabolic pathways
lln01130  Biosynthesis of antibiotics
lln01230  Biosynthesis of amino acids
Module
lln_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LLNZ_04555
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LLNZ_04555
Enzymes [BR:lln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LLNZ_04555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ADJ59898
Position
857234..858040
Genome map
AA seq 268 aa AA seqDB search
MTRKNILKAQRIVVKIGTSSLILPNGKINLSNIDELAFVLSDLNNKGYEVILVTSGAIGV
GLNVLGMDKRPKGIADQQALASIGQVELMSLYTQMFRRYSQKVSQLLLTRDVTDFPTSRE
NAENALNALLALDIIPIINENDAIAVDEMDHQTKFGDNDKLGAIVSKLVHADLLIMLSDI
DGLFDKNPTIYDDAKIFNEIHEITDELRQMAGGAGSRFGTGGMTSKLAAAQILFENDQEM
VLTNGERIREIQQIIEGREIGTYFHQKF
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaaaaaatattttgaaagctcagcgaattgtggtgaagattggcacgagttcc
ttgattttgccaaatggaaaaataaatttatcaaatattgacgaactggcttttgtctta
tctgatttgaataataaaggttatgaagtgattttggtgacttctggggcgattggtgtg
ggcttgaatgtccttggaatggataaacgtccaaaaggaatcgcagaccaacaggctttg
gcttctatcggtcaggtcgaattgatgagtctgtatacgcaaatgtttcgccgttattca
caaaaagtttcgcaattacttttgactcgtgatgtaactgattttccaacgagtcgtgaa
aatgctgaaaatgcattgaatgctctacttgcactggatattatcccgattatcaatgaa
aatgatgcaattgctgttgatgaaatggaccatcaaacaaaatttggcgataatgataaa
ctgggagcgattgtgtctaagttggttcatgccgatttgttgattatgctttcagatatc
gatggactttttgataaaaatccgacgatttatgatgatgctaaaatttttaatgaaatt
catgaaattactgatgaattacgccaaatggctggaggtgccggttctcgttttggtact
ggtgggatgacttcgaaattggcggctgcccaaattttatttgaaaatgatcaagaaatg
gttctgaccaatggcgagcggattcgagaaattcaacaaattatcgaaggacgtgagatt
ggaacatattttcatcaaaaattttga

DBGET integrated database retrieval system