KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_04810Help
Entry
LLNZ_04810        CDS       T02131                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LLNZ_04810
Enzymes [BR:lln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LLNZ_04810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
905056..905901
Genome map
AA seq 281 aa AA seqDB search
MKKQYEIISMKDHYRIRLGIFEPQEKAKGVVQLVHGFGEYTGHYLYLINELVNAGFVCFM
HDQRGHGVLAAAKPKLQGRARNYENFISDALEVRKIIGKRYPKLPVYLFGHSMGGNISLN
VLLRNVENQKLYQKAVIESPWLALTNPPAIPLQKLAQVLGKFNSKIRVRTGLKVDAISHR
SDLVDLVTKDGIYHELLSLRLFSQIMEAGRFAQSQAEQLKIPTLLFCGEEDQICSPLAIR
SFAENAGANLELVEVAEGYHALHLDTKADAFIDKMKAFLLE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacagtatgaaattatttcaatgaaagatcactatcggattcgtcttggaatt
tttgaaccacaagaaaaagcaaaaggcgtggtgcaattagttcatggttttggcgaatat
acgggtcattatttatatttaatcaatgaattagttaatgctggttttgtttgctttatg
cacgaccaaagaggacatggggttctagcagcagctaaacctaaacttcaaggacgagca
agaaattatgaaaactttattagtgatgctttagaagtccgaaaaataattggcaaaaga
tatcccaaattaccagtttatctcttcggacacagtatgggaggaaatatttcactgaat
gttctgctgagaaatgttgaaaatcaaaaactttatcaaaaagcagttattgaatctcct
tggcttgccttgacaaatccaccggctattcccctacaaaagttggctcaagttttaggg
aaatttaattcaaaaattagagttcgtacgggacttaaagttgatgcaatctctcatcgg
agtgacttagttgatttagtgactaaagatggaatatatcatgaactattatctttacgt
ttgttttcacaaattatggaagcaggacgttttgcccaaagtcaggccgagcagttaaag
ataccgaccttattattttgtggagaagaagaccaaatttgttcaccgttagcgattcgt
tcctttgctgaaaatgctggtgctaatttggaattagttgaagttgctgagggctatcat
gcccttcatttagatactaaagcagatgctttcattgacaaaatgaaggctttcctgctt
gaataa

DBGET integrated database retrieval system