KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_04930Help
Entry
LLNZ_04930        CDS       T02131                                 

Definition
Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lln00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
926555..927037
Genome map
AA seq 160 aa AA seqDB search
MALCYYLSAAIEANSFEDRALNGVITKNPYIDATEWKWPIDPYGFKHYLHDYYHRYQLPI
LITENGMGARDTLKEDGTVNDDYRIKYLADHIARMKEAVEEGVEMIGYLTWSATDLYSTR
EGFEKRYGFVYIDKDYKRIKKRGFDWYKKVISTNGEDLSY
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtgttactatttatcagctgcaattgaagctaatagttttgaagatagggcc
ttgaatggtgtgattactaaaaatccttacattgatgcaacagaatggaaatggccaatt
gatccatatggttttaaacattatttacatgattattatcatcgctatcaattaccgata
ttaattactgaaaatggtatgggggcaagggatactttgaaagaggacggaacggttaat
gatgattacagaattaagtatttagcagaccatattgctcgtatgaaagaagcggttgaa
gagggagtagaaatgattggttatcttacatggtctgcaacggacctttactctactcgt
gaaggttttgaaaaacgttatggttttgtttatatagataaagattataaacgtatcaaa
aaacggggctttgactggtacaaaaaagtgatttcgacaaacggagaagatttaagttac
taa

DBGET integrated database retrieval system