KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_05170Help
Entry
LLNZ_05170        CDS       T02131                                 

Definition
XylA protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lln00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lln00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
969287..969982
Genome map
AA seq 231 aa AA seqDB search
MAYFNDIAPIKYEGTKTKNMFAFRHYNPEEVVAGKTMEEQLHFALAFWHTITMDGADPFG
SATMERPWDLEGGSELDRAHRRVDAFFEIAEKLGVKYYCFHDIDIAPTGNSLKEFYANLD
EITDHLLEKQKETGIKLLWNTANMFSNPRYMNGVSTSNRAEVFAYGAAQVKKGLELSKKL
DGENYVFWGGREGYESLLNTDMGLEMDHMAKFFHLAIDYAKWFCCKVLNKE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcttactttaacgacatcgcacctatcaaatacgaaggtacaaaaactaaaaacatg
tttgccttccgccattataacccagaagaagtggttgctgggaaaacaatggaagaacag
cttcatttcgcccttgctttttggcatacaattacgatggacggggctgacccatttggt
agtgccacaatggaacgtccttgggacttggaaggtggctctgaacttgaccgtgctcat
cgtcgagtagatgctttctttgaaattgccgaaaaattgggtgttaaatattattgtttc
catgatattgacatcgcgcctacaggaaattctttgaaagaattttatgcaaacttagat
gaaattactgaccatcttcttgaaaaacaaaaagaaacaggcattaaactcctctggaat
acggcaaatatgttctcaaacccacgttatatgaatggggtttcgacatcaaatcgtgct
gaagtttttgcttatggtgctgctcaagtcaaaaaaggacttgaactttctaaaaaactt
gatggtgaaaactatgtattctggggtggtcgtgaaggttacgaatcacttttgaacaca
gacatgggtcttgaaatggatcacatggcaaaattcttccatttggcgattgattatgca
aaatggttctgttgcaaagttttaaataaagaataa

DBGET integrated database retrieval system