KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_05370Help
Entry
LLNZ_05370        CDS       T02131                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00260  Glycine, serine and threonine metabolism
lln00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lln01100  Metabolic pathways
lln01110  Biosynthesis of secondary metabolites
lln01130  Biosynthesis of antibiotics
lln01230  Biosynthesis of amino acids
Module
lln_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLNZ_05370
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LLNZ_05370
Enzymes [BR:lln01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LLNZ_05370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADJ60043
Position
1003090..1004295
Genome map
AA seq 401 aa AA seqDB search
MTYNQPNNQGFYGQFGGQFVPETLMTAVKELEVAYEDSKKDPVFQAELKELLKDYVGREN
PLYFAKRLTEYAGGAKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGAGQHG
VATATAAALFGMECTIYMGEEDVKRQSLNVFRMELLGAKVHSVTDGSRVLKDAVNAALRA
WVAQVEDTHYVMGSVLGPHPFPQIVRDYQAIIGQEARAQFLEKENKLPDALVACVGGGSN
SMGLFYPFVNDESVEMYGVEAAGLGIDTPHHAATITKGRPGVLHGTLMDVLQDENGQILE
AFSISAGLDYPGIGPEHSYFNAVGRAKYVDITDEEALEGFKILSRTEGIIPALESSHAIA
YAVKLAKELGSEKTMIVCLSGRGDKDVVQVKERLEAEKEVK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaatcaacccaataaccaaggattttatggacaatttggtggacaatttgtc
cctgaaactttaatgacagccgtaaaagaattagaagtagcttatgaagacagtaaaaaa
gatccagtttttcaagctgaactaaaagaattgcttaaagattacgttggacgagaaaac
ccactttattttgctaaacgcctgaccgaatatgctggtggtgcaaaaatttatctcaaa
cgcgaagaccttaatcacaccggagctcacaaaataaataacgcccttggccaagtcctc
cttgccaaaaaaatgggaaaaaacaaagtcattgctgagacaggagcgggccaacatgga
gtcgcaacggcaacagcggctgccctctttggcatggaatgtaccatatatatgggtgaa
gaagatgtcaaaagacaatctcttaatgtttttcggatggaattgctcggtgcaaaagtc
cattcagttactgatggttcgcgcgtgcttaaagatgcggtaaatgcagcacttagagca
tgggttgctcaagttgaggatacacattatgtgatgggttcagttctcggacctcaccca
ttcccacaaattgttcgtgattatcaagccatcattggtcaagaagcacgtgcacaattc
ttagaaaaagaaaataaactaccagatgctttagtggcttgtgttgggggcggttcaaac
tcgatgggacttttctacccattcgttaatgacgaatcagtagagatgtatggtgttgaa
gcagctgggcttgggatagatactccacaccatgcagcaacaattactaaagggcgtcca
ggggttttacacggcacgcttatggatgttcttcaagatgaaaatggacaaatactagaa
gctttcagtatttctgctggtttagactatccaggaattggacctgaacattcctatttc
aatgcggtcggccgtgcaaagtatgttgatattactgatgaagaagcccttgaaggtttc
aaaatcttatctcgcacagaaggaatcataccggcccttgaaagctctcacgcgattgcc
tatgcggtcaaattagctaaagaattaggttcagaaaaaacaatgattgtttgcttatca
ggtcgcggcgataaagatgttgttcaagttaaagaacgtcttgaagcagaaaaagaggtg
aaataa

DBGET integrated database retrieval system