KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_05375Help
Entry
LLNZ_05375        CDS       T02131                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LLNZ_05375 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLNZ_05375 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LLNZ_05375 (trpA)
Enzymes [BR:lln01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LLNZ_05375 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1004295..1005056
Genome map
AA seq 253 aa AA seqDB search
MKTLQAKLSNKKNNFVPYIMAGDHERGLEGLNETIQLLEQAGSSAIEIGVPFSDPVADGP
VIEQAGLRALAKNVSLSKILDSLKSIETEVPLVIMTYFNPVYQFGIENFVAALESTAVKG
LIIPDLPKEHEAYIKPFITDKDICLVPLVSLTTPISRQKELVVDAEGFIYAVAINGVTGK
ENAYSNQLDHHLETLSKLTDIPVLTGFGISTLTDVERFNKVSAGVIVGSKIVRDLHENKE
SDVIKFIENAINF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacaagcaaaattgagcaataaaaaaaataattttgttccctatattatg
gcaggtgaccatgaaagaggattagaagggctcaatgaaaccattcaacttcttgaacaa
gccgggagttctgccattgaaattggtgtacccttctcagaccccgttgctgacggacca
gtaattgaacaagctggcttacgagccttagccaaaaatgtttcactatcaaagattctt
gacagcttaaaatcaattgaaacagaagttcctcttgtcattatgacttattttaatcct
gtctatcagtttggaattgaaaattttgttgcagctcttgagagtacagcagtaaaaggt
ctaattattcctgatttacctaaagaacatgaagcttacattaagccttttattactgat
aaggatatttgcttagtacctttggtgtcattaaccacaccaatttctcgtcagaaagaa
cttgtagtagatgccgaaggattcatttatgccgttgcgatcaatggagtaaccggaaaa
gaaaatgcttatagtaatcaacttgaccatcatttagaaacattgtctaaattaactgat
attcctgttttgacaggatttgggatttcaactttaacagatgttgaacgttttaataag
gtatcagcaggagtaatcgttggttcaaaaatagttagggatttacacgaaaacaaagaa
agtgatgttattaaatttattgaaaacgcaatcaatttttaa

DBGET integrated database retrieval system