KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_05630Help
Entry
LLNZ_05630        CDS       T02131                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LLNZ_05630
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LLNZ_05630
Enzymes [BR:lln01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LLNZ_05630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1046970..1047443
Genome map
AA seq 157 aa AA seqDB search
MNFYDFSAVKMNGETVSMSDYKGKVVIVVNTASKCGFTPQFEGLEKLYETYKDQGLEILG
FPCNQFANQDAGENTEINEFCQLNYGVTFTMFQKIKVNGKEAHPLYQFLKKEAKGALSGT
IKWNFTKFLIDRDGQVIERFAPKTEPEEMEEEIKKLL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttatgattttagtgccgttaaaatgaacggtgaaactgtttcaatgtctgac
tacaaaggaaaagtcgtaatcgtagtcaatacagccagtaaatgtggttttactccacaa
tttgagggacttgaaaaattgtatgaaacatataaagaccaaggattagagattctagga
tttccttgtaatcagtttgctaatcaagatgctggtgaaaatacggaaattaatgaattc
tgtcagttgaattatggggttacattcaccatgtttcaaaaaattaaagtaaatggaaaa
gaagctcatccactttatcaatttttgaaaaaggaagccaaaggggcgcttagtggaact
attaaatggaatttcacaaagtttttaattgaccgagatggacaagtcattgaacgattt
gctcccaaaacggagcctgaagaaatggaagaagaaatcaaaaaattactttaa

DBGET integrated database retrieval system