KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_05755Help
Entry
LLNZ_05755        CDS       T02131                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LLNZ_05755
   00052 Galactose metabolism
    LLNZ_05755
   00500 Starch and sucrose metabolism
    LLNZ_05755
   00520 Amino sugar and nucleotide sugar metabolism
    LLNZ_05755
Enzymes [BR:lln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LLNZ_05755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1073148..1074089)
Genome map
AA seq 313 aa AA seqDB search
MKQTTIPNKARKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALKSGIE
DILIVTGKAKRPIEDHFDSNIELEQNLLEKGKTELLKLVEETTDINLHFIRQSHPKGLGH
AVLQAKAFVGNEPFVVMLGDDLMNITGNETPLTKDLINDYEKTHASTIAVMKVPHEDVDK
YGVIDPNGEVSKGLYNVERFVEKPKVEEAPSDLAIIGRYLLTPEIFDVLETQVPGAGNEI
QLTDAIERLNKTQRVFAHEFTGKRYDVGDKLGFVETTIEYGLEHPQIGDNLKNYIIEKAK
ELSKDELKQNTKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaactactatacctaacaaagccagaaaagttcgtaaagctgttattcctgct
gctggtcttgggactcgctttttaccagcaactaaagccattgccaaagaaatgttgcca
attgttgataaacctactatccaattcatcgttgaagaagctttgaaatctggaatcgaa
gacattttgattgtaactggtaaagcaaaacgtccaattgaagaccattttgactcaaat
attgagcttgaacaaaatttacttgaaaaaggaaaaacagaattacttaaacttgttgaa
gaaacaacagatatcaatcttcattttatccgccaatctcatccaaaaggtttgggacac
gctgttcttcaagccaaagcttttgttggcaacgaaccttttgtagttatgcttggtgat
gatttgatgaatatcacaggcaatgaaactcctttgactaaagacttgattaatgattat
gaaaaaactcatgcttcaacaatcgctgtaatgaaagtgcctcatgaagatgttgacaaa
tacggagtaatcgaccctaatggcgaagtttctaaaggtctttacaatgttgaacgtttc
gttgaaaaaccaaaagttgaggaagctccttcagaccttgcaattatcggtcgttacctc
ttgactccagaaatttttgatgttttagaaacacaagtacctggtgctggaaatgaaatt
caattaactgatgcgattgaacgtttgaataaaacacaacgtgtctttgctcatgaattt
actggaaaacgttatgatgttggtgataaacttggttttgtggaaacaacaatcgagtat
ggtttagaacatccacaaatcggcgacaatttgaaaaattatatcatcgaaaaagctaaa
gaactttctaaagatgaactaaaacaaaatacaaaaaaataa

DBGET integrated database retrieval system