KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_05780Help
Entry
LLNZ_05780        CDS       T02131                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLNZ_05780
   01230 Biosynthesis of amino acids
    LLNZ_05780
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLNZ_05780
   00030 Pentose phosphate pathway
    LLNZ_05780
   00051 Fructose and mannose metabolism
    LLNZ_05780
   00052 Galactose metabolism
    LLNZ_05780
  Energy metabolism
   00680 Methane metabolism
    LLNZ_05780
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LLNZ_05780
Enzymes [BR:lln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LLNZ_05780
Protein phosphatases and associated proteins [BR:lln01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LLNZ_05780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1079014..1080036
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDK
IGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMGRNAGDIALNA
GIAAGADDICIPEKEFKFENVVNNINKGYEKGKNHHIIVLAEGVMTGEEFATKLKEAGYK
GDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGIRNEELVESPILGT
AEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNLN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcagttttgacttctggtggtgatgccccagggatgaatgcggctatt
cgtgcagttgttcgcaaagcaatttctgaaggtatcgaagtttacggtatcaatcacgga
tatgcgggcatggttgcgggagacattttcccgcttacgtcagcttcagttggtgataaa
atcggtcgtggtggtacattcttgtactcagcacgttacccagaatttgctcaagtagaa
ggacaacttgctgggattgagcaacttaaaaaattcggtatcgaaggtgtcgttgtaatc
ggtggtgacggatcttaccatggagctatgcgtcttacagaacatggtttcccagctgtt
ggacttccaggcacaatcgataacgatatcgtaggaactgattttacaattggttttgat
acagctgtttcgacagtcgtagatgccttggataaaatccgtgatacttcatcatcacat
aaccgtactttcgttgtagaagtaatgggacgtaatgctggagatatcgctttgaatgct
ggtatcgctgctggtgcagatgatatttgtattccagaaaaagaatttaagtttgaaaac
gtagttaacaacattaacaaaggctacgaaaaaggtaaaaatcaccacatcatcgttctt
gctgaaggcgttatgactggtgaagaatttgctacaaaacttaaagaagctggttataaa
ggagaccttcgtgtttctgttcttggacacatccaacgtggtggttcaccaacagctcgt
gaccgtgttcttgcttcacgtatgggagctcgtgccgttgaattgcttcgtgatggaatc
ggtggcgtagccgttggtatccgtaatgaagaacttgtagaaagtccaattctcggaact
gctgaagaaggagcactctttagtttgactactgaaggtggcatcaaagtaaacaacccg
cataaagcaggtcttgaactttaccgtcttaactcagcactcaacaatcttaaccttaac
taa

DBGET integrated database retrieval system