KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_05780Help
Entry
LLNZ_05780        CDS       T02131                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:lln01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lln01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lln00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lln00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lln00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lln00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:lln00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1079014..1080036
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDK
IGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMGRNAGDIALNA
GIAAGADDICIPEKEFKFENVVNNINKGYEKGKNHHIIVLAEGVMTGEEFATKLKEAGYK
GDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGIRNEELVESPILGT
AEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNLN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcagttttgacttctggtggtgatgccccagggatgaatgcggctatt
cgtgcagttgttcgcaaagcaatttctgaaggtatcgaagtttacggtatcaatcacgga
tatgcgggcatggttgcgggagacattttcccgcttacgtcagcttcagttggtgataaa
atcggtcgtggtggtacattcttgtactcagcacgttacccagaatttgctcaagtagaa
ggacaacttgctgggattgagcaacttaaaaaattcggtatcgaaggtgtcgttgtaatc
ggtggtgacggatcttaccatggagctatgcgtcttacagaacatggtttcccagctgtt
ggacttccaggcacaatcgataacgatatcgtaggaactgattttacaattggttttgat
acagctgtttcgacagtcgtagatgccttggataaaatccgtgatacttcatcatcacat
aaccgtactttcgttgtagaagtaatgggacgtaatgctggagatatcgctttgaatgct
ggtatcgctgctggtgcagatgatatttgtattccagaaaaagaatttaagtttgaaaac
gtagttaacaacattaacaaaggctacgaaaaaggtaaaaatcaccacatcatcgttctt
gctgaaggcgttatgactggtgaagaatttgctacaaaacttaaagaagctggttataaa
ggagaccttcgtgtttctgttcttggacacatccaacgtggtggttcaccaacagctcgt
gaccgtgttcttgcttcacgtatgggagctcgtgccgttgaattgcttcgtgatggaatc
ggtggcgtagccgttggtatccgtaatgaagaacttgtagaaagtccaattctcggaact
gctgaagaaggagcactctttagtttgactactgaaggtggcatcaaagtaaacaacccg
cataaagcaggtcttgaactttaccgtcttaactcagcactcaacaatcttaaccttaac
taa

DBGET integrated database retrieval system