KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_09655Help
Entry
LLNZ_09655        CDS       T02131                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lln00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1858544..1859926)
Genome map
AA seq 460 aa AA seqDB search
MQYLLHSQLTEAVDYCHKLGIALKGDIAIGIAHDSVDAWTHPELFHLDKQAGAPPDVFAV
NGQNWGFPTYNWEKMAEDGYDWWKKRLTAMSNYFDAYRLDHILGFFRIWQMPENSVRGLL
GQFSPALALSAEEIENNYGIPFRQWGIERFIIPFIKDWVIDEVFGRDNRDWIIQTFLDYI
GTGNYRFKAEFNNQKAIENTQMENWVREGLYKLQENVIFLKDDENSEKYHPRIGLLSTIS
FREFGDDYKGRLERLYNDYFYGRNYDFWKEKAYEKLPALKNATKMLACGEDLGMVPDNVP
DVMYHLDILRLIIERMPADERFVSSLSEVPYLSVVTTSSHDTSPLRAWWEENHDLTQRYY
NEVMGWYGEAPNYASVEIIQEIIKRNLNSNAMMVILPIQDWLAMSEHFRKENAKSEQINI
PADSYHYWNYRLHCNLEALIENQEWTDFLKSFIKESKRAY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatatcttctccattctcaacttactgaagcagtagattattgtcataaattagga
attgctttaaaaggagacatagcgattggaattgctcacgattctgtagatgcatggacc
catcccgaactttttcatcttgataaacaagctggtgcgcctcctgatgtttttgccgta
aatggacaaaactggggattcccaacttataattgggaaaagatggctgaagatggctat
gattggtggaaaaaacgtctaaccgccatgtcaaattactttgatgcttatcgcctcgac
catattcttggattctttagaatatggcaaatgccagaaaattcggtaagaggattgcta
ggtcaattttcacccgcactggctttgtcagcagaagaaattgaaaataattatggaatt
ccattccgacaatgggggattgagcgcttcatcatacctttcatcaaagattgggtgata
gacgaagtttttggtcgagataatcgtgattggattattcaaacatttttagactatatt
ggtactggtaactatcgttttaaagcagaattcaacaaccaaaaagcgatagagaatact
caaatggagaactgggttcgcgaaggactttataaattacaagaaaacgtgattttttta
aaggatgatgaaaatagtgaaaagtatcatccacgaattggtctgttatccacaataagt
tttcgagaatttggtgatgactacaaaggacgattagagcgactttacaatgactatttt
tatggtcgaaattatgatttttggaaagaaaaagcctatgaaaaattgccagccttaaaa
aatgcgaccaagatgttggcatgtggtgaggacttagggatggtgccagataatgtgcca
gatgtgatgtatcatcttgatatcttacgactgattattgaacgaatgcctgctgatgaa
cggtttgtcagctcattaagtgaagttccatatttatcagtagtaaccacatctagccat
gataccagccctttaagagcttggtgggaagaaaaccatgatttaactcaacgttattac
aacgaagtcatgggttggtatggagaagcgccaaactatgcgagtgtggaaattatccaa
gaaataattaagagaaatttaaattctaatgccatgatggttatcttacctatccaagat
tggttagcaatgagtgagcattttagaaaagaaaatgcaaaatctgaacaaattaatatt
cctgcagattcgtatcattactggaattatcgactccattgtaatcttgaagcattgatt
gaaaatcaagaatggaccgattttctaaagagctttattaaagaaagcaagcgagcttat
taa

DBGET integrated database retrieval system