KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_09755Help
Entry
LLNZ_09755        CDS       T02131                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLNZ_09755
   01230 Biosynthesis of amino acids
    LLNZ_09755
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLNZ_09755
  Energy metabolism
   00680 Methane metabolism
    LLNZ_09755
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLNZ_09755
Enzymes [BR:lln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LLNZ_09755
Exosome [BR:lln04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LLNZ_09755
  Exosomal proteins of melanoma cells
   LLNZ_09755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1874105..1874686
Genome map
AA seq 193 aa AA seqDB search
MTEVYFIRHSLRDNAAYDDMDVPLTAEGEKRALILADAFEHTSIDQIFSSPFQRSVRTLN
PLAHSKNLEIQLISDLRERNVGHEIADFWPFAKRQWKDFDYKLADGESLREVQNRNISAL
EKILATSKNQKVAIGTHGTSLSTILNFYQPDFQFQDFQSLAGKMPYVIKMDFAENNYLTH
QVIEIDYDNKKSY
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtttattttattcgacattctcttagagataatgcagcctatgacgatatg
gatgttccgctgactgccgagggtgaaaaacgcgcacttatcttagctgatgcttttgaa
catacttcgattgatcaaattttttccagtccatttcaacgttctgttcgtaccctgaat
cctcttgctcactctaaaaatcttgaaattcaactcatttctgatttgagagaaagaaat
gttggccatgaaatagctgatttttggccttttgcaaagcgacaatggaaagattttgat
tataaacttgctgacggagaatcattacgtgaagttcaaaatcgtaatatttcagccctt
gaaaagattttagcaacttctaaaaatcaaaaagttgcaatcggaactcatggtacttct
ctttctaccattttaaatttttatcaaccagactttcagtttcaagattttcaatcttta
gctggcaaaatgccctatgtcatcaaaatggactttgctgaaaataattatctgacccac
caagtcattgaaattgattatgacaataaaaaaagttactga

DBGET integrated database retrieval system