KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_09895Help
Entry
LLNZ_09895        CDS       T02131                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lln00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LLNZ_09895
Enzymes [BR:lln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LLNZ_09895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1902607..1905108)
Genome map
AA seq 833 aa AA seqDB search
MTDKTYVTGSIEAIFFSNPSNFYKVLLIEIDETNAEYDDFEIVVNGTIGDVVEGDSYTFY
GQLTQHPKYGEQLQVSQYEKAVPTSGAGLVKYFSSDKFPGIGKKTAEKIVETFPENTVDS
ILEAPEKLDGLLTLARKNSFIKRLRENHGMEKVLTKLAEYGLPSKLTFQIYELYKEETIE
KIEGNPYQLVEEVKGVGFKTADKIASELGIEADSPNRFRAALMHEVNTHSQATGDTYIEA
KNLLELTIDLLEEARNIEVNPAEVAAEINGLIVDGKVQQEGTKIFENSLFFAEDGIRKSL
TALTNRSGKDFADEKLLTVLEEVEKDLEITYDELQKQAIIGAMNQQFFILTGGPGTGKTT
IINGFIETYARLYQLDLEPDHYNDDVFPILLAAPTGRASRRMNELTGLPAATIHRHLGLG
QDEAEDAIGNELSGSLLIVDEFSMVDTWLANKLFQAIPGSMKVLLVGDADQLPSVGPGQI
FADLLKIPEIPSVKLDKIFRQGDDSTITDLAHHIKDGQLPADFTVKKPDRSYFEVSANFV
PQMVEQIASAWQKRGNNPFELQILAPMYKGTAGINAMNILLQNLFNPLNDRLEFALGDMK
FREGDKVLHLVNDAEANVFNGDLGQIVELIAAKYTDSKQDEIVMDFDGQELTYPRAEWYK
ITLAYAMSIHKSQGSEFSTVIVPMVSSYSRMLERNLLYTAITRAKQSLILLGEERAFAQA
VAREGANRKTFLVERFKDDKPAAENLSVDSLTKKVTDKKEISNKEKNSGSAADLDLENFS
GRKKTAPKVEEISLFDEETESLGNGILTEALILSGNFDPLIGLTEQDFAIFNK
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacggataaaacttatgttacaggctcaattgaagctatttttttctctaatccaagc
aatttttataaagttttattaattgagattgatgaaacaaatgctgaatatgatgatttt
gaaattgtggtcaatgggacaattggcgatgtagtcgaaggggattcttatactttttat
gggcaattaacccagcatccaaagtatggggaacaattgcaagtcagtcaatatgagaag
gctgtaccaacgtctggtgctggtttggtcaagtatttttcatcagataaatttccaggg
attggtaaaaaaacggcagagaaaattgttgaaacttttcctgaaaatacggtagattct
attttagaagcgcctgagaaattggatggtttattaactctagccagaaaaaattcattt
atcaaacgtttgcgtgaaaatcatggtatggaaaaagtgctgaccaagcttgcagagtat
ggcttgccaagtaaactcacttttcaaatctatgagttgtacaaagaggaaacgattgaa
aaaattgagggaaatccttatcaacttgtggaagaagttaaaggggttggctttaaaact
gccgataagattgcgagtgaactagggattgaagcggatagtccaaatcgttttcgagcg
gctttgatgcacgaagtcaatacgcattcgcaagcaacaggtgatacctacattgaagcc
aagaatttacttgagttgacgatagacttacttgaagaagccagaaatattgaggtcaat
ccagctgaagttgctgcggaaataaatggtttaattgttgatggaaaagtacagcaagaa
ggaacgaaaatatttgaaaattccttgttttttgctgaagacggtatccgaaaatcactg
acagccttaactaatcgttcgggaaaagattttgctgacgaaaagttactgacagttttg
gaagaggtagaaaaagatttagagattacttatgatgaacttcagaaacaggccatcatt
ggagcgatgaatcagcaatttttcattttgactgggggaccaggaacggggaaaacaacg
attattaatggtttcattgaaacttatgcccgtctttatcagttagatttagaacctgac
cattataatgatgacgtttttcctattttactggcggcaccgactggtcgcgcttcaaga
cggatgaatgagttgactggacttccagcagcaacaattcatcggcacttaggcttaggg
caagatgaggcagaagatgcgattggtaatgagttgtcaggttcacttttgattgtcgat
gaattttcaatggttgatacttggctagccaacaaactttttcaagccattcctggttca
atgaaagtccttctcgttggcgatgctgaccaacttccttctgtgggccctggacaaatt
tttgcagatttattaaaaattccagaaattccatcagtaaaattggataagatttttcgt
cagggagatgattcaacgattaccgatttggctcatcatatcaaagatggacaattacct
gcagattttacggtgaaaaaacctgaccgttcttattttgaagtgagtgctaattttgta
ccacaaatggtggagcaaattgctagtgcttggcaaaaaagaggaaataatccttttgaa
ttacaaattttagcgcccatgtataaagggaccgctgggattaatgcaatgaatattctc
ttgcaaaatctctttaatccgcttaatgaccgacttgaatttgctttgggtgatatgaaa
tttcgtgaaggagataaagtattacatttagtcaatgacgctgaggccaatgtattcaat
ggagatttaggacaaattgttgaattgattgcagcaaaatatactgacagtaaacaagat
gagattgtgatggattttgatggtcaagaattgacctatcccagagctgaatggtataaa
attacgcttgcttatgctatgtctatccataaatcccaaggttcggaattttcaacggtc
atcgtcccgatggtctcttcttattcacggatgttagagcgaaatttactatatacagca
atcacgcgggcaaagcaaagcttaattttattgggtgaagagcgtgcctttgctcaggct
gtggcgcgtgaaggagccaatcgaaaaacttttctcgttgagcgttttaaggatgataag
cctgccgcagaaaatctgtcagtagattccttaactaaaaaagttactgacaagaaggaa
atatctaacaaagagaaaaattctggatcagcagcagacttagacttagaaaatttttct
ggcagaaaaaaaacagcaccaaaagttgaggaaatttcattatttgatgaagaaactgaa
agtttggggaatggaattctaacagaagcgctaattttatctggcaattttgatccctta
attggattgactgagcaagattttgcgatttttaataaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system