KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_10275Help
Entry
LLNZ_10275        CDS       T02131                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00010  Glycolysis / Gluconeogenesis
lln00071  Fatty acid degradation
lln00350  Tyrosine metabolism
lln00625  Chloroalkane and chloroalkene degradation
lln00626  Naphthalene degradation
lln01100  Metabolic pathways
lln01110  Biosynthesis of secondary metabolites
lln01120  Microbial metabolism in diverse environments
lln01130  Biosynthesis of antibiotics
lln01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLNZ_10275
  Lipid metabolism
   00071 Fatty acid degradation
    LLNZ_10275
  Amino acid metabolism
   00350 Tyrosine metabolism
    LLNZ_10275
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LLNZ_10275
   00626 Naphthalene degradation
    LLNZ_10275
Enzymes [BR:lln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LLNZ_10275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N DZR Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADJ60968
Structure
PDB: 

Jmol
Position
complement(1978859..1979881)
Genome map
AA seq 340 aa AA seqDB search
MKAAVVRQNPDGYADVVEKELRMIKPNEALLDMEYCGVCHTDLHVAAGDYGNKAGTVLGH
EGIGIVKEIGSEVTSLKVGDRVSVAWFFEGCGHCEYCVSGNETFCREVKNAGYSVDGGMA
EQAIVTADYAVKVPEGLDPIEASSITCAGVTTYKAIKVSGVKPGDWQVIFGAGGLGNLAI
QYAKNFFGAKVIAVDINQDKLDLAKKIGADVIINSGEVNPIDEIKKITGGLGAQSAVVCA
VARIAFEQAVASLKPMGKMVAVALPNTEMTLSVPTVVFDGVEVAGSLVGTRLDLAEAFQF
GAEGKVKPIVATRKLEEINEIIDEMKAGKIEGRMVIDFTK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtagtacggcaaaatccggatggctatgcggatgttgttgaaaaggaa
cttcggatgattaagcccaatgaagctttactcgacatggaatattgtggagtctgtcat
acagacttgcatgtagcagcaggcgattatggcaacaaagctggaacggtccttggtcat
gaaggaatcggtattgtcaaagaaattggtagtgaagtcacttccttaaaagttggagat
cgcgtgtcagtcgcttggtttttcgaaggatgtgggcattgcgaatactgtgtttctggt
aatgaaactttttgtcgagaggtcaaaaatgctggttattcagttgacggtggaatggcc
gaacaagcgattgtaacagctgattatgcggtaaaagttccagagggacttgatcctatt
gaagcaagttcaatcacttgtgctggagttacgacttacaaagcaatcaaggtttctgga
gttaagccaggagattggcaagtcatctttggtgccggtggactaggtaatctagctatt
caatacgctaaaaatttttttggggcaaaagtaattgcagttgatattaatcaagataaa
ttagacttagctaaaaaaattggtgcagatgtgattatcaattctggtgaagtcaatcca
attgatgaaataaaaaaaatcactggtggtttaggagcacaaagtgctgttgtttgcgcc
gttgcaagaatagcatttgaacaagcagtcgcttctttgaaaccaatgggtaaaatggtt
gcggtggcactgcctaataccgaaatgactttgtctgttccgacagttgtttttgatggt
gtggaagttgctggctcacttgttggaacaagacttgatttagcagaagcatttcaattt
ggtgctgaaggtaaagtcaaaccaattgttgcgacacgcaagcttgaagaaatcaatgag
attattgatgaaatgaaagcaggaaaaattgaaggccggatggtcattgattttactaaa
taa

DBGET integrated database retrieval system