KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_11885Help
Entry
LLNZ_11885        CDS       T02131                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLNZ_11885
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLNZ_11885
   00052 Galactose metabolism
    LLNZ_11885
   00500 Starch and sucrose metabolism
    LLNZ_11885
   00520 Amino sugar and nucleotide sugar metabolism
    LLNZ_11885
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LLNZ_11885
   00524 Butirosin and neomycin biosynthesis
    LLNZ_11885
Enzymes [BR:lln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LLNZ_11885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2251818..2252789
Genome map
AA seq 323 aa AA seqDB search
MTASKIIGIDLGGTSIKFGILTLTGEVQDKWSIPTNILEDGKHIVPDIIQSINHRLNLYN
LDKSEFLGIGMGTPGSVNISESTVKAAFNLNWADTQEVGKPISEGVGLPFILDNDANVAA
LGERWVGAGENNPDVVFITLGTGVGGGIIASGELVHGIAGAGGEIGHICVDPDGFECTCG
NRGCLETVTSATGIVRLARKFAEEYEGDSTIKAAIDNGDEVTSKDIFFAAQEGDHFSLSV
VDKFAYYLGFACANLGSTLNPASIVIGGGVSAAGEFLREKVETYFNKYAFSTVRNSSKIK
LAVLGNDAGIIGAASLALKFKGE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaagtaaaattatcggtatcgaccttggcggaacttcaattaaatttgggatt
ttaactctcactggtgaagttcaagataaatggtctatcccaacaaatattttagaagat
ggaaaacatatcgttcctgatattatccaatcaatcaaccaccgtttgaacctttacaat
ttggataaatcagagtttctcggaattggaatgggaactcctgggtcagtaaatatttct
gaaagtactgttaaagccgctttcaacttaaactgggcagacactcaagaggttggtaaa
ccaatttctgagggtgttggtctacctttcatcttggacaatgacgctaacgttgctgct
cttggtgaacgttgggttggggctggtgaaaacaatcctgatgtagtcttcatcactctt
ggaactggtgttggtggtggaattatcgcctcaggagagctagttcatggtattgctgga
gctggtggtgaaatcggccacatttgcgttgaccctgatggttttgaatgtacttgtgga
aaccgcggatgtttggaaacagtaacttctgctacaggaatcgttcgcttagctcgtaaa
tttgctgaagagtacgaaggagattctactattaaggctgctattgacaatggtgatgaa
gtaacttctaaagacattttctttgctgctcaagaaggggaccacttcagcttatctgtt
gttgataaatttgcttattatcttggatttgcctgtgcaaatttgggttctactttaaac
cctgcttcaatcgttattggtggtggtgtatcagcagctggtgaattcttgcgtgaaaaa
gttgaaacttatttcaataaatatgccttttcaactgttcgtaactcaagtaaaattaaa
cttgctgttcttggaaatgatgccggaattatcggcgctgcaagtcttgctcttaaattt
aaaggagaataa

DBGET integrated database retrieval system