KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_12570Help
Entry
LLNZ_12570        CDS       T02131                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LLNZ_12570
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLNZ_12570
   00620 Pyruvate metabolism
    LLNZ_12570
   00650 Butanoate metabolism
    LLNZ_12570
  Lipid metabolism
   00071 Fatty acid degradation
    LLNZ_12570
  Amino acid metabolism
   00350 Tyrosine metabolism
    LLNZ_12570
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LLNZ_12570
   00626 Naphthalene degradation
    LLNZ_12570
Enzymes [BR:lln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LLNZ_12570
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LLNZ_12570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2383881..2386592
Genome map
AA seq 903 aa AA seqDB search
MATKKAAPAAKKVLSAEEKAAKFQEAVAYTDQLVKKAQAAVLKFEGYTQTQVDTIVAAMA
LAASKHSLELAHEAVNETGRGVVEDKDTKNHFASESVYNAIKNDKTVGVIAENKVAGSVE
IASPLGVLAGIVPTTNPTSTAIFKSLLTAKTRNAIVFAFHPQAQKCSSHAAKIVYDAAIE
AGAPEDFIQWIEVPSLDMTTALIQNRGIATILATGGPGMVNAALKSGNPSLGVGAGNGAV
YVDATANIDRAVEDLLLSKRFDNGMICATENSAVIDASIYDEFVAKMQAQGAYMVPKKDY
KAIESFVFVERAGEGFGVTGPVAGRSGQWIAEQAGVNVPKDKDVLLFELDKKNIGEALSS
EKLSPLLSIYKSETREEGIEIVRSLLAYQGAGHNAAIQIGAMDDPFVKEYGIKVEASRIL
VNQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNVKTVAKRRNRPQWVR
LPKEIYYEKNAISYLQELPHVHKAFIVADPGMVKFGFVDKVLEQLAIRPTQVETSIYGSV
QPDPTLSEAIAIARQMKQFEPDTVICLGGGSALDAGKIGRLIYEYDARGEADLSDDASLK
EIFQELAQKFVDIRKRIIKFYHPHKAQMVAIPTTSGTGSEVTPFAVITDDETHVKYPLAD
YQLTPQVAIVDPEFVMTVPKRTVSWSGIDAMSHALESYVSVMSSDYTKPISLQAIKLIFE
NLTESYHYDPAHPTKEGQKARENMHNAATLAGMAFANAFLGINHSLAHKIGGEFGLPHGL
AIAIAMPHVIKFNAVTGNVKRTPYPRYETYRAQEDYAEISRFMGFAGKEDSDEKAVKALV
AELKKLTDSIDINITLSGNGVDKAHLERELDKLADLVYDDQCTPANPRQPRIDEIKQLLL
DQY
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaaaaaagccgctccagctgcaaagaaagttttaagcgctgaagaaaaagcc
gcaaaattccaagaagctgtcgcttatactgatcaattagtcaaaaaagctcaagctgca
gttcttaaatttgaaggatacacacaaactcaagttgatactattgttgctgcaatggct
cttgcagcaagcaaacattctctggaactcgctcacgaagccgttaatgaaactggccgt
ggagttgttgaggacaaagatacaaaaaaccattttgcttctgaatctgtttataatgca
atcaaaaatgataaaacagttggcgttatcgctgaaaacaaagttgctggttctgttgaa
atcgcaagcccccttggagtacttgctggtattgtcccaacaactaatccaacatcaaca
gccatctttaaatcattattaactgcaaagacacgtaatgctattgtctttgcctttcac
ccacaagcacaaaaatgctcaagccatgcggcaaaaattgtttatgatgctgcgattgaa
gctggtgcacctgaagactttattcaatggattgaagtacccagtcttgatatgacgact
gctttgattcaaaatagaggaattgctacaattcttgcaactggtggtccaggtatggtc
aatgccgcgcttaagtctggtaatccttcacttggtgtaggtgctggtaatggtgcagtt
tatgttgatgcaactgcaaatatcgatcgtgctgttgaagatcttttgctttcaaaacgt
tttgataacggaatgatttgtgcgactgaaaactctgcagttattgatgcatcaatctat
gatgaatttgtcgctaaaatgcaagcgcaaggcgcttatatggttcctaaaaaagattac
aaggcaattgaaagttttgttttcgttgaacgtgctggtgaaggttttggtgtaactggt
cctgttgctggtcgttctggtcaatggattgctgaacaagctggtgttaacgtccctaaa
gataaagatgttcttctttttgaacttgataagaaaaatattggggaagctctttcttct
gaaaaactttctcctttgctttcaatctacaaatcagaaacacgtgaagaaggaattgaa
attgtacgtagcttacttgcttaccaaggagctggtcacaacgctgccattcaaatcggt
gcaatggacgacccatttgtcaaagaatacggaattaaagtcgaagcttctcgtatcctc
gttaaccaacctgactctatcggtggggtcggagatatttatactgatgcaatgcgtcca
tcattgacgctcggaactggttcatgggggaaaaattcactttcacacaatttgagtaca
tacgatctattgaatgttaaaacagtggctaaacgtcgtaatcgccctcaatgggttcgt
ttgccaaaagaaatttactacgaaaaaaatgcaatttcttacttacaagaattgccacac
gtccacaaagctttcattgttgccgaccctggtatggttaaattcggtttcgttgataaa
gttttggaacaacttgctatccgcccaactcaagttgaaacaagcatttatggctcagtc
caacctgacccaactttgagtgaagccattgcaatcgctcgtcaaatgaaacaatttgaa
cctgacactgtcatctgtcttggtggtggttctgctctcgatgctggtaagattggtcgt
ttgatttatgaatatgatgctcgtggtgaggctgacctttccgatgacgcaagtttgaaa
gagatcttccaagagttagctcaaaaatttgttgatattcgtaaacgtattatcaaattc
taccacccacacaaagcacaaatggttgctatccctactacttctggtactggttctgaa
gtgactccatttgcggttatcactgatgatgaaactcacgttaaatatccacttgctgac
tatcaattgacacctcaagttgccattgttgaccctgagtttgttatgactgtaccaaaa
cgtactgtttcttggtctgggattgatgctatgtcacacgcgcttgaatcttatgtttct
gtcatgtcttctgactatacaaaaccaatttcacttcaagccatcaaactcatctttgaa
aacttgactgagtcttatcattatgacccagctcatccaaccaaagaaggtcaaaaagct
cgcgaaaacatgcacaatgctgcaacactcgctggtatggccttcgccaatgctttcctt
ggaattaaccactcacttgctcataaaattggtggtgaatttgggcttcctcatggtctt
gccattgctatcgctatgccacatgtcattaaatttaacgctgtaacaggaaacgttaaa
cgtaccccttacccacgttatgaaacttatcgtgcgcaagaagactacgctgaaatttca
cgcttcatgggatttgctggcaaagaagattcagatgaaaaagcggtcaaagctttggtt
gctgaacttaaaaaattgactgatagtattgatattaatatcaccctttcaggaaatggt
gtagataaagctcatcttgaacgtgagcttgataaattggctgaccttgtttacgatgac
caatgtacacctgctaatccacgtcaaccaagaattgatgagattaaacaactcttgtta
gaccaatattaa

DBGET integrated database retrieval system