KEGG   Legionella longbeachae: LLO_0062Help
Entry
LLO_0062          CDS       T01183                                 

Gene name
ahpC
Definition
alkyl hydroperoxide reductase
Orthology
K03386  
peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
llo  Legionella longbeachae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
68787..69392
Genome map
AA seq 201 aa AA seqDB search
MSVLVGRKAPDFTVAAVLANGEIVDKFNLHEHLKGKYGLVFFYPLDFTFVCPSELIALDH
RIDEFKSRNVEVVTVSIDSHFTHNAYRNTPVNKGGIGSVRYTMAADITHSICQSYGVEHP
AAGVAFRGAFIIDTNGIVRSQIVNDLPIGRNVDELLRIIDAVQHFEENGEVCPAGWQKGK
AGMTASTEGVAAYLSEHSDSL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtattagtgggaagaaaagctcctgattttactgtagctgctgttttggcaaat
ggtgaaattgtggataaatttaatttacacgagcatttgaaaggtaaatatggtcttgtg
tttttttatcctttggattttacctttgtatgcccttccgagttgattgctttagatcat
cgcattgatgaatttaaaagccgtaacgtcgaggtggttactgtttctattgattcacac
tttactcataacgcatatagaaatactccggtaaacaagggcggtattggttctgtccgt
tatacaatggccgcagacataactcatagtatttgtcagtcctatggcgtggagcatcct
gctgcaggtgttgctttccgtggagcatttattattgataccaatggcattgttcgctca
caaattgtcaatgacttgcccatcggccgtaacgtagatgaacttcttagaatcatagat
gctgtacagcactttgaagaaaacggtgaggtttgccctgctggttggcaaaaaggaaaa
gcaggtatgaccgcttcaacagaaggggtggctgcatatttgtcagagcattctgattca
ttataa

DBGET integrated database retrieval system