KEGG   Legionella longbeachae: LLO_0203Help
Entry
LLO_0203          CDS       T01183                                 

Definition
lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
llo  Legionella longbeachae
Brite
Enzymes [BR:llo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LLO_0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(222216..223001)
Genome map
AA seq 261 aa AA seqDB search
MIYDDFRCMSRGKQLLTLKEEDFSLLHPINQQGTKKDRALLLFHGFTSSPAVYRYLIPQL
KNYDAVVCPALPGHADSIAAFAKAKRNDWVSHANQECDTLFKEYQKVDVLGVSLGALLAC
KLSRNYSFNHMFLLAPALKLQMNINRNIKLIMLLKSLGFCELRGMAGNLVSDKHTEISYR
RIPLSALLELFALIQEHQWVPPNCPTDLFLGTHDRVVASKEVENMFAHLPKANIHWLANS
AHVLPLDNDLDQIVQCVNQCI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgatgattttcgctgtatgagccgtggaaaacaactccttactttgaaagaa
gaggacttctcacttctccaccccattaatcaacaaggcacaaaaaaagatcgcgccctg
ctgctttttcatggatttacgtcatcccctgctgtttatcgttacctcattccccaatta
aaaaattatgatgcggtagtgtgtccggcactaccggggcatgccgacagtattgctgct
tttgccaaggcaaaaagaaatgattgggtatcgcacgctaatcaagaatgtgacacatta
ttcaaagaataccaaaaggtagatgtattgggagtatcccttggtgctttgctggcatgc
aaactgagccgaaattattcattcaaccacatgtttcttttagcccctgcactaaaactg
cagatgaatattaatcgcaatataaaattaatcatgctacttaagagtctgggcttttgc
gagctccgtggcatggctggtaatcttgtcagtgataagcacactgaaatttcttatcgt
agaatcccactttctgcactacttgaactatttgccttaatccaagagcatcaatgggta
cctcctaactgccccactgatctttttcttggaacacatgatagggttgttgcatcaaaa
gaagtagaaaatatgtttgctcatctacccaaagcaaacatacactggcttgcaaactca
gcccacgttctccctttggataatgatttggatcaaattgttcagtgtgtgaatcaatgc
atatag

DBGET integrated database retrieval system