KEGG   Legionella longbeachae: LLO_0275Help
Entry
LLO_0275          CDS       T01183                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
llo  Legionella longbeachae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLO_0275 (tpi)
   01230 Biosynthesis of amino acids
    LLO_0275 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_0275 (tpi)
   00051 Fructose and mannose metabolism
    LLO_0275 (tpi)
   00562 Inositol phosphate metabolism
    LLO_0275 (tpi)
Enzymes [BR:llo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LLO_0275 (tpi)
Exosome [BR:llo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LLO_0275 (tpi)
  Exosomal proteins of bladder cancer cells
   LLO_0275 (tpi)
  Exosomal proteins of melanoma cells
   LLO_0275 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
310210..310959
Genome map
AA seq 249 aa AA seqDB search
MRQTIVAGNWKMNGQLRQVVQLTNEIKELLQSIKKTRVVIMPPAIYIPQVRDLVAECDIA
LGAQNVYPKDFGAYTGEISAPMLKDFNCRYILVGHSERRHGFQEDEKFVAQKFHHVKEHG
MIPILCVGETLGEREKGHTEQVIANQLLAVSEADKNCFSDCVVAYEPVWAIGTGKTASPE
QAQEVHRFIRKLVAGVNDSDAQQLPLLYGGSVNEDNARALFSMPDVDGGLVGGASLNAKQ
FVEIVKCIN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagacagacaatagtcgctggcaactggaaaatgaatggtcagctacgccaggtagtt
caattaaccaatgagattaaagaactgctccagtctattaaaaagacccgtgttgtaatt
atgccgcctgcaatttatataccgcaagtaagagacttagtggcggaatgtgatattgcg
ctaggggcacagaatgtatacccaaaggatttcggtgcatataccggcgagatttctgct
cccatgttaaaagactttaactgccgttatattttggtaggtcattctgaaagaagacat
ggatttcaggaagatgaaaaatttgtcgcgcaaaaattccaccatgtgaaagaacatggt
atgatacccattctttgtgtcggtgaaactctaggtgagcgcgaaaaaggacatacagaa
caagtaattgcaaatcaactactggcggtaagtgaagcggataaaaactgctttagtgat
tgtgtagtggcttacgaacctgtttgggcaataggtactggaaagactgcatcaccagaa
caagctcaagaagttcatagattcattaggaagttggttgcaggagtaaatgatagcgat
gcacaacaactacccctcctttatggtggtagtgtaaatgaagataatgctagggcacta
ttttcgatgccagatgttgatggtggcttggtagggggagcatcgttgaacgcgaaacag
tttgtggaaattgtgaaatgtatcaattga

DBGET integrated database retrieval system