KEGG   Legionella longbeachae: LLO_0324Help
Entry
LLO_0324          CDS       T01183                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
llo  Legionella longbeachae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LLO_0324 (hemD)
Enzymes [BR:llo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LLO_0324 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(367401..368159)
Genome map
AA seq 252 aa AA seqDB search
MKRSLNGLRILNTRPQEQAHKLTESIRASGGIAIELPALEIQASNSDWVDLLPNLDNVTH
AIFISANAVHYCFTQLNQLQINWPTSIQVIAIGQGTASSLQKFNIQVSAIPEFPNSEHLL
SLDTLQHLENQNVLLFKGKEGRPLIEEQLMQKGAKLVILKVYQRVMPKPSPLLVQSIWRD
DLVDIILLTSEQSLLNLFKIFDKEAHDWLKSKRWLVISERIAQIASSLGIHKINIIHPNQ
VLNTLFDYVNKD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggtcgcttaatggtttgcgcattttaaatacccgacctcaagagcaagcacat
aagctcaccgaaagcattcgtgcttcaggaggaattgctatagagctccctgccctggaa
attcaagcatcaaatagcgattgggttgatttgttaccgaacttggacaacgtgacgcat
gctatttttattagcgctaatgcggttcattattgctttactcaactaaatcaactgcag
ataaattggcctacatcaatccaggtcattgcaattggccaaggaacagcctcctcgctg
caaaaatttaacatccaggtgagtgccatccctgaattccctaatagtgaacatttattg
tcattagacacattacaacacctggaaaatcaaaacgtgctactatttaaaggaaaagaa
ggcagaccgctcattgaagagcaactgatgcaaaaaggagctaagctagttattttaaag
gtatatcaaagagttatgccaaaaccaagtcctttacttgtgcaatcgatatggcgcgat
gacttggtggatattatactgttaacaagcgaacagtctctgcttaaccttttcaaaata
tttgataaagaggctcacgattggctaaaaagcaaaagatggctagttattagtgagcgt
atcgctcaaattgcctcttcattaggaatacataagattaatataattcaccctaatcag
gtgctgaatacattgtttgactacgtaaacaaggattaa

DBGET integrated database retrieval system