KEGG   Legionella longbeachae: LLO_0330Help
Entry
LLO_0330          CDS       T01183                                 

Gene name
nagZ
Definition
(GenBank) beta N-acetyl-glucosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
llo  Legionella longbeachae
Pathway
llo00520  Amino sugar and nucleotide sugar metabolism
llo01100  Metabolic pathways
llo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LLO_0330 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    LLO_0330 (nagZ)
Enzymes [BR:llo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LLO_0330 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 YycC
Motif
Other DBs
NCBI-ProteinID: CBJ10658
Pasteur: llo0330
UniProt: D3HP45
Position
complement(372705..373796)
Genome map
AA seq 363 aa AA seqDB search
MPGSNSNLFMIDLEGTELSDIERKILKHPNLGAVILFTRNFANPEQLEKLTSEIHALNPD
IFIATDHEGGFIQRFLRHGFRALPAARVYGDVYDLSPEAGIKLARQYGEVMAKDLLTCGV
DLSLAPVLDLHDMSPIIAHLDRSFHHDPDAVTALANAFIEGMNTVGMPAVGKHFPGHGRI
SSDSHTTMPVSTASFDQLKSRDLKPFIELISNERLSAIMPAHVTYKAVDANKPAGFSAIW
LQEILRHELGFTGLILSDCLSMTGADIGNLKTRAEEALNAGCDMLIVCHQPRHILLELLQ
NVAFPQSDESAMRIIQFKSQMFRFSHSEKNQVVPSLSHTLLGQQEHHTDCTSQNLQFNTS
KTI
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcccggttcaaactctaatttatttatgattgatcttgaaggcactgagctttctgat
attgaacgaaaaatcttgaaacaccctaaccttggagcggtcattcttttcacccgcaac
ttcgctaatccagaacaattagaaaaattaacctcggaaattcacgcgctcaatccagat
attttcatagctactgatcatgaaggcggatttatccagcgctttttacgccatggcttc
cgcgctttacccgctgctcgtgtctatggtgatgtatatgacctatcccccgaagcaggg
attaaactcgcaagacagtatggagaggtcatggccaaggatttattaacgtgtggtgtt
gatttaagccttgcacctgttcttgatttacatgacatgagtcctattattgctcactta
gatcgctctttccaccatgatcctgatgcagttacagctctggcaaacgcattcattgag
ggaatgaatactgtaggaatgcctgccgtaggcaaacactttcctggacatggtcggatc
agttccgattcacacaccacaatgcctgtttccactgcttcttttgatcaattgaaaagc
agggacttaaaaccatttattgagttaataagcaacgagcgtttaagcgcgatcatgcct
gctcatgtgacttataaggctgtggacgccaataaaccggctggcttttcagcgatttgg
ttacaagaaattttacgccacgagttaggatttaccggtttgattttgagcgattgcttg
agtatgaccggtgcggatataggtaatttaaagacacgcgctgaagaagcacttaatgca
ggttgtgatatgttgatcgtctgccaccaaccacgacatatactcttggaattattgcaa
aatgtagcatttccccaatccgacgaatcggctatgcgtattatccagtttaaaagccaa
atgttccgattttctcattctgaaaaaaatcaagtggtaccttctttatcgcacactttg
cttgggcagcaagaacatcatacagattgcacgagtcaaaatttgcagtttaatacttca
aaaacaatttag

DBGET integrated database retrieval system