KEGG   Legionella longbeachae: LLO_0330Help
Entry
LLO_0330          CDS       T01183                                 

Gene name
nagZ
Definition
beta N-acetyl-glucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
llo  Legionella longbeachae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LLO_0330 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LLO_0330 (nagZ)
Enzymes [BR:llo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LLO_0330 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(372705..373796)
Genome map
AA seq 363 aa AA seqDB search
MPGSNSNLFMIDLEGTELSDIERKILKHPNLGAVILFTRNFANPEQLEKLTSEIHALNPD
IFIATDHEGGFIQRFLRHGFRALPAARVYGDVYDLSPEAGIKLARQYGEVMAKDLLTCGV
DLSLAPVLDLHDMSPIIAHLDRSFHHDPDAVTALANAFIEGMNTVGMPAVGKHFPGHGRI
SSDSHTTMPVSTASFDQLKSRDLKPFIELISNERLSAIMPAHVTYKAVDANKPAGFSAIW
LQEILRHELGFTGLILSDCLSMTGADIGNLKTRAEEALNAGCDMLIVCHQPRHILLELLQ
NVAFPQSDESAMRIIQFKSQMFRFSHSEKNQVVPSLSHTLLGQQEHHTDCTSQNLQFNTS
KTI
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcccggttcaaactctaatttatttatgattgatcttgaaggcactgagctttctgat
attgaacgaaaaatcttgaaacaccctaaccttggagcggtcattcttttcacccgcaac
ttcgctaatccagaacaattagaaaaattaacctcggaaattcacgcgctcaatccagat
attttcatagctactgatcatgaaggcggatttatccagcgctttttacgccatggcttc
cgcgctttacccgctgctcgtgtctatggtgatgtatatgacctatcccccgaagcaggg
attaaactcgcaagacagtatggagaggtcatggccaaggatttattaacgtgtggtgtt
gatttaagccttgcacctgttcttgatttacatgacatgagtcctattattgctcactta
gatcgctctttccaccatgatcctgatgcagttacagctctggcaaacgcattcattgag
ggaatgaatactgtaggaatgcctgccgtaggcaaacactttcctggacatggtcggatc
agttccgattcacacaccacaatgcctgtttccactgcttcttttgatcaattgaaaagc
agggacttaaaaccatttattgagttaataagcaacgagcgtttaagcgcgatcatgcct
gctcatgtgacttataaggctgtggacgccaataaaccggctggcttttcagcgatttgg
ttacaagaaattttacgccacgagttaggatttaccggtttgattttgagcgattgcttg
agtatgaccggtgcggatataggtaatttaaagacacgcgctgaagaagcacttaatgca
ggttgtgatatgttgatcgtctgccaccaaccacgacatatactcttggaattattgcaa
aatgtagcatttccccaatccgacgaatcggctatgcgtattatccagtttaaaagccaa
atgttccgattttctcattctgaaaaaaatcaagtggtaccttctttatcgcacactttg
cttgggcagcaagaacatcatacagattgcacgagtcaaaatttgcagtttaatacttca
aaaacaatttag

DBGET integrated database retrieval system