KEGG   Legionella longbeachae: LLO_0341Help
Entry
LLO_0341          CDS       T01183                                 

Gene name
pheS
Definition
phenylalanyl-tRNA synthetase, alpha subunit
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
llo  Legionella longbeachae
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:llo00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
382998..384011
Genome map
AA seq 337 aa AA seqDB search
MQDIITIQEQAAEAIKNAQDVSGLEQIRVDFLGKKGKLTEILKSLAHLSAEEKPKVGQLV
NQVKREISALIETKMLELKQKQLSEKLSAERIDVTLPGRKKESGSLHPVTQVKHRINEFF
SRMGFDIVDGPEIETEFYNFEALNIPAHHPARAMHDTFYFGDGRLLRTHTSPVQIRTMEQ
RKPPFRLIAPGRVYRCDSDLTHTPMFHQVEGLLVDKHATLASLKGLLQDFFADFFGRQLA
LRFRPSYFPFTEPSAEVDIECTQCSGEGCRSCKFTGWLEVLGCGMVHPNVLKAVNISPDE
FQGWAFGMGMDRLAMLYYGIDDLRMMFENDLSFLSQF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatatcatcaccatacaagaacaggctgctgaagcgattaaaaacgctcaggat
gtttctggattagagcaaattcgcgttgattttttgggtaagaagggaaaactcactgaa
attttaaaaagtcttgcccatttatccgctgaagaaaaaccaaaagtaggccagcttgtg
aatcaagtaaaacgagaaatcagtgctttgattgaaacgaaaatgcttgagctgaagcaa
aagcaactgtcagaaaagctgtcagctgaacggattgatgtaacacttcctggtcgtaag
aaggaaagtgggtccttacatccagtaacccaagtaaagcataggattaatgaatttttt
agtcgtatgggatttgatattgttgatggacccgaaattgaaactgaattttataatttt
gaggcactcaatattcctgcacatcatccagctcgtgcaatgcatgataccttttatttt
ggtgatggccgtcttttgcgaacacatacatcgccagtacaaattcgtacaatggagcaa
cgcaagcccccgtttcggttaatcgccccagggcgagtttatcgttgtgactcagacctg
actcatacgccgatgtttcatcaggttgaaggactactggtggacaaacacgctactttg
gcgagcttaaaaggtctactacaagatttttttgctgatttttttggacgtcaattagca
ttgcgatttagaccctcgtattttccctttacagaaccttcagctgaagttgatattgaa
tgtacccaatgtagtggtgaggggtgtcgctcttgtaaattcactggatggttagaagtt
ttaggttgcggtatggttcatcccaatgttctaaaagcagtcaatatctcgcctgatgaa
tttcagggatgggcatttggaatgggtatggatcgattagccatgttgtattatgggata
gatgacttgcgtatgatgtttgaaaatgacttgtcttttttaagtcaattttga

DBGET integrated database retrieval system