KEGG   Legionella longbeachae: LLO_0398Help
Entry
LLO_0398          CDS       T01183                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase subunit E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
llo  Legionella longbeachae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLO_0398 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LLO_0398 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    LLO_0398 (sucB)
Enzymes [BR:llo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LLO_0398 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
448442..449671
Genome map
AA seq 409 aa AA seqDB search
MSIEVKVPVLPESVADATIAAWHKKVGDKVSRDENLLDLETDKVVLEVPAPVDGILSEIM
FQEGDTVHSGQLLAKIKEGDAAEPKEEKKAGSKEEKKAEQADSTKENVSAKEDKSTSPVV
RRMMAEHDLQPGQIQGSGKDGRITKEDVLAYIESSREKSSKPAESPKEQTTQVQMGVREE
RRVPMTRLRAKIAERLLAAQHNAAMLTTFNEVNLKAVMDMRAQYKDSFEKKHGVKLGFMS
FFTKAVVESLKRFPAVNASIDGQDVVYHGFYDIGIAVSTDRGLVVPVIRDADQMSMANIE
LAINDAATKARQGKLAMEDMQGGTFTITNGGVFGSLLATPIINPPQTGILGMHKIEERPV
VEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPARLLLNV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgaagtcaaagtccctgttttgcctgagtcagtagcggatgcaacaatagct
gcttggcataaaaaagtgggtgataaagtttcccgtgatgaaaatttgttggatctagaa
acagacaaagtcgttcttgaggttccagctccggttgatggaatattaagtgaaataatg
tttcaagagggagacacggtccattcaggacaattgctcgcaaaaataaaggaaggcgat
gcagctgaaccaaaagaagaaaagaaggctggttccaaagaggaaaagaaagcagagcag
gctgattctacaaaagaaaatgtgagtgctaaagaagataaatcaacaagtccggtggta
aggcgaatgatggcagaacatgatcttcagccaggacaaatccaaggcagcggaaaagat
ggtcgcattacaaaagaagacgttcttgcctatatagaatcaagcagagaaaaatcatca
aaacccgcagaaagcccaaaagaacaaacaacgcaggtacaaatgggggtacgtgaagag
cgccgtgttccaatgacacgattacgggcaaaaattgcagagcgcttattagcagcacaa
cataacgcagcgatgctgactactttcaatgaagttaatttaaaagcagtgatggacatg
cgtgctcaatataaagacagttttgagaaaaagcatggtgttaagcttgggtttatgtcc
tttttcacgaaagcggttgttgaatcattaaagcgttttcctgcggtaaatgcttctata
gatggtcaagatgtggtgtatcatggtttttatgatataggtattgccgtgtctaccgat
agagggctggttgtgcctgtaatccgtgatgcagatcaaatgagtatggctaatattgaa
ctggcaattaatgatgctgcaacaaaagccagacaaggtaaattggctatggaagatatg
caaggtggtacatttactataaccaatggcggggtgtttggttctttattggctactcca
atcattaatcccccacaaacaggtattttgggaatgcacaagatagaagaaagacctgtg
gtggaaaaaggacaaattgtaattcgtcctatgatgtatgtggctctgtcttatgatcat
cgtttaattgatggtaaagattcagtccaatttctggtgagtgtgaaagagctattggaa
gatcccgctcgtcttttacttaatgtttaa

DBGET integrated database retrieval system