KEGG   Legionella longbeachae: LLO_0440Help
Entry
LLO_0440          CDS       T01183                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
llo  Legionella longbeachae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LLO_0440 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LLO_0440 (btuE)
Enzymes [BR:llo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LLO_0440 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
506092..506619
Genome map
AA seq 175 aa AA seqDB search
MMTHIASADTLHYDNAYDYSFHTLRGHEPLPLSSFQGKVLMVVNTASKCGFTPQYARLEE
LYEKYKDRGLVILGVPSNDFGGQEPGTEQEISNFCQLNYGVSFPMTAKEVVSGKNAHPFY
LWARKELGFGTAPKWNFHKYLINRKGKLIDYFYSTTSPDAGKVIKVIEKALDEHV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccatatcgcttcagctgatacgttgcattatgataatgcgtatgattattca
tttcatactttacgaggacacgagccattacctctttcctcttttcaaggaaaagtttta
atggtagtaaatactgcttctaaatgtggatttactccgcaatatgctcgcctagaggag
ctctatgaaaaatataaagaccggggtttggttatattaggagttccttcaaatgatttt
ggggggcaagaaccaggaacagaacaagaaatttctaacttttgccaattaaattatggt
gttagctttccaatgacggctaaggaagtggtttcaggaaaaaatgcacatccattttat
ctttgggcaagaaaggagttgggatttggtacagcaccaaagtggaatttccataaatat
cttatcaaccggaagggaaagttaattgattatttttattcgaccacttctccagatgca
ggaaaagtgattaaagttattgagaaagcattagacgagcatgtttaa

DBGET integrated database retrieval system