KEGG   Legionella longbeachae: LLO_0839Help
Entry
LLO_0839          CDS       T01183                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
llo  Legionella longbeachae
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LLO_0839 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    LLO_0839 (dapE)
Enzymes [BR:llo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LLO_0839 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(967181..968350)
Genome map
AA seq 389 aa AA seqDB search
MIQYSGIVSSHRLEALQKILDTLISFPSITPEDAGCQEFMIQFLEQAGFTCQRMNQGPVS
NFFASYGETGPLLVFAGHTDVVPIGELSKWSTDPFVLENREGFLYGRGVADMKGSLACML
LMAQRFIKAYPQFHGRLGFLITSAEEGEDYDMGTPYVMQLLATQGIHIDYCIVGEPSSTH
TVGDVIKIGRRGSLNAKINIQGKQGHVAYPHLADNPIHKMSPVLTRLTTTVWDQGNTHFP
PTSMQITHMHSGGHAANIIPGELVLHLNFRYSTEQTHHALKEKVVSAFQEFNLNPVIEWR
LSGEPFLTAHGCLLESCKEAIIEITGNAPELSTSGGTSDGRFIAPYGVEVIELGPVNATI
HQVNECISLNQLDELETLYFLICEKIFIK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgatccaatactcaggcatcgtttcttctcatcgtctcgaagcgttacaaaaaatttta
gacacgcttattagttttccctcgattaccccagaagatgctggatgtcaggagtttatg
attcaatttttagaacaagcagggtttacttgccaacgaatgaatcaaggccctgtatct
aatttttttgcatcctatggcgaaacggggcctcttttagtctttgcaggccatacagat
gtagttccaattggtgaactctcaaaatggtcgactgatccttttgtgctcgagaatcga
gaaggattcctctatggacgcggggtagctgatatgaagggcagtctcgcgtgtatgctc
ttgatggcgcaacgttttattaaagcgtatccccaatttcacggaagattaggctttctg
ataacaagtgcagaagaaggtgaggattatgatatgggtacaccttacgtgatgcagctt
ttagcaactcaaggtattcatattgattactgtattgtaggtgaaccttcaagtactcac
accgtaggcgatgtcattaaaattggcaggcgagggtcactgaatgcaaaaatcaatatt
cagggaaaacaaggtcatgtcgcctaccctcatttggcagataaccccatacataaaatg
agtcctgtattaaccagacttactactacagtctgggatcaaggcaatacccattttcca
ccgacttcgatgcaaattacccacatgcattctggcggccatgctgcaaatatcatcccg
ggtgaactggtattacatcttaattttagatattcaacagaacagacccatcatgcatta
aaagaaaaagtagtttctgccttccaagaatttaaccttaatccagtcatcgaatggcgt
ctgagcggtgaaccatttctaacagcccatggttgcttgctcgaaagttgcaaggaggca
atcatcgagatcacaggaaacgcccccgaattatctacaagtggaggtacgtcagatggt
cgttttatagccccctatggtgttgaggttattgagcttgggcctgtaaatgcaacaatc
catcaagttaatgaatgtatttccttaaaccaattagatgaattggaaacgttatatttt
ttaatttgtgaaaaaatattcattaagtaa

DBGET integrated database retrieval system