KEGG   Legionella longbeachae: LLO_0858Help
Entry
LLO_0858          CDS       T01183                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
llo  Legionella longbeachae
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:llo00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:llo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
983756..985207
Genome map
AA seq 483 aa AA seqDB search
MKLSQLLKPWMKQSIMDCLITGLENDSRRIHPGDLFIAYAGAAADGRLFIDNAVSSGAVA
VAYDPADFPLNCVLPESVPCIPVPELSTQLPNIAKQFYDNPACFLNITGVTGTNGKTTIA
YQLAQAHHLLGQKAAYIGTIGQGNVNELRLVDNTTPDSLCLQKLLHQYKSQDMRQVCMEV
SSHALAQHRVDALEFNQAIFTNLTLDHLDYHHSMENYARAKSLLFARESLEWAIINQDDA
YHKIMAAAIKPQVKKLTYGIHQDCDVRAKNWSMDIYGTEIEVHSPWGKHHIKIKSLGQFN
IYNSLAIFSSLLAANYIPEQVVDVMAQLKAAPGRMEIVAHSPYVLVDYAHTPDALENALM
TLNQLKKGRLWVVFGCGGDRDKTKRPIMGKVADKLADEIVITSDNPRTEEPQIIINEISK
GIALSTKVIQLVNREEAIAYALDKADENDVILIAGKGHESYQQIGTVKHQFSDQDVVRSL
IPK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctcacaattattgaaaccttggatgaaacaatcgataatggattgtctgatt
acggggctggaaaatgacagccgccgaattcatccaggagatttgtttatagcctatgca
ggtgctgcagctgatggtcgtttatttatagataatgcggttagttctggagcggttgca
gttgcttatgatccggctgattttcctttaaactgcgtactccctgaatctgttccttgt
attcccgtaccagagttatcaacacaacttcctaatattgcaaaacagttttatgataat
ccagcatgttttttaaacataaccggagtaacaggtactaatggaaaaacaacaattgcc
tatcaacttgctcaagcacatcatttactaggtcaaaaagctgcctatataggtactatt
ggtcaaggtaatgtgaatgaattgcgactggtggataatacaactcccgactctttgtgt
ttacagaaattattgcatcaatataagagtcaggatatgcggcaagtatgtatggaggtg
tcctctcatgcactggcacaacatcgcgttgatgcccttgaatttaatcaagctatattt
actaacttaactttagatcatttagattatcatcatagtatggaaaactatgccagggca
aagtcattattattcgccagagagtccctggagtgggcaattatcaatcaagatgatgcc
tatcataagattatggctgctgcaattaaaccgcaagtaaaaaaattaacttatggaata
catcaggattgtgatgttagagctaaaaactggtctatggatatttatggcacggagatt
gaagtacactcgccttgggggaagcatcacataaaaataaaatctttagggcaatttaat
atttataatagcctggcaatatttagtagtttattggccgctaattatatccctgaacaa
gtagttgatgtaatggcccaattaaaagccgcaccaggacgtatggaaattgttgcccat
tccccgtatgttttggttgattatgctcatacgcctgatgctttagagaacgctttaatg
actttaaatcaattgaaaaaagggcgtttatgggtagtatttggttgtggcggtgatagg
gataaaaccaaaagacctattatggggaaggttgctgataagctggcggatgaaattgtt
attacaagtgataatccacgcaccgaagagccacaaataattatcaatgaaatttcaaag
ggtattgccctatctactaaagtaattcaattggtaaatcgtgaggaagcaattgcttat
gctttagataaagcagatgaaaacgacgttattctaattgcaggaaaagggcatgaatca
tatcaacagattggtactgtgaaacatcaattttctgatcaagatgtagtaagaagttta
atcccgaaataa

DBGET integrated database retrieval system