KEGG   Legionella longbeachae: LLO_0885Help
Entry
LLO_0885          CDS       T01183                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
llo  Legionella longbeachae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LLO_0885 (galU)
   00052 Galactose metabolism
    LLO_0885 (galU)
   00500 Starch and sucrose metabolism
    LLO_0885 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LLO_0885 (galU)
Enzymes [BR:llo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LLO_0885 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1017324..1018199)
Genome map
AA seq 291 aa AA seqDB search
MNATFSSVRKAVFPVAGLGTRFLPATKAAPKEMLTVVNKPLIQYAVEEAYDAGIREMIFV
TCHNKTAIEDHFDLAYQLENELRNHDKNELLSIVQSVTPSDMECFYVRQAKPLGLGHAVL
CAEKIVGNDAFAVILADDLMTGQIPVIKQLIQLYETYGHSIIAVENVPKELTECYGIIQG
VPWNNNILNVHHLVEKPKPDQVSSNTAIVGRYVLTPAIFDKIRALPHKEHKEIQLTDAIN
ALLQNESVLACLYEGKRYDCGSVLGFLKANVDLGKIHPIEGESFSKWLTTE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgacattttcttccgtaagaaaggctgtatttcctgtggcgggtttaggaacg
cgatttttacccgcaacaaaagcagcacctaaagaaatgttaactgtagttaataaaccc
ttaattcaatatgctgttgaagaagcttatgatgctggcatacgagaaatgatttttgtc
acttgccataacaaaacagccattgaagatcattttgatctcgcctatcaattggaaaat
gagctaagaaaccatgataaaaatgaactcttatctatagttcaatccgttactccttcg
gatatggagtgtttttatgtccgtcaggcaaaaccgcttggactggggcatgccgtttta
tgtgccgagaaaattgtaggtaatgatgcatttgcagtaattctggctgatgatttaatg
actggacaaataccggttattaaacagttgatccaattatacgaaacatacggtcatagt
attatagcagtagaaaatgtaccaaaagaattaaccgaatgttatggaattattcaaggt
gtcccgtggaataataacattttaaatgtacaccatttagtagaaaaaccgaagccagat
caagtttcatcaaatacagctatagtggggcgctatgttcttacaccagctatttttgat
aaaatcagggcattacctcataaagagcataaagaaattcaactgactgatgcaatcaat
gccctgctccaaaacgaatcagttttagcatgtctgtatgagggaaagcgttatgattgt
ggtagcgtacttggatttttaaaagcgaacgtagatttaggaaaaatacatccaattgaa
ggtgaaagtttttccaaatggcttacaacagaataa

DBGET integrated database retrieval system