KEGG   Legionella longbeachae: LLO_0906Help
Entry
LLO_0906          CDS       T01183                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
llo  Legionella longbeachae
Pathway
llo00230  Purine metabolism
llo01100  Metabolic pathways
Module
llo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LLO_0906 (gmk)
Enzymes [BR:llo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LLO_0906 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_22 MobB PRK MMR_HSR1 NTPase_1
Motif
Other DBs
NCBI-ProteinID: CBJ11253
Pasteur: llo0906
UniProt: D3HQT3
Position
1039573..1040211
Genome map
AA seq 212 aa AA seqDB search
MSIIVGDYLGNLFIVAAPSGGGKTSLVRRLVETLDSIEVSISHTTRPMRPGEQHGKDYFF
VDEKEFICMVNECAFLEYARVFNHLYGTSMEQITKRLNEGIDVVLDIDWQGAQQIRHSFP
DAVGIFIVPPSLEELKQRLLNRRQDKDEVISDRMKKAQDELSHYSEFNYLIVNDNFERAA
MELGAIVLANRLRIERQINKQAKLLSFLMSSQ
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgagtataattgtgggtgattatttaggtaatttgtttatagtggctgcaccttcaggg
gggggcaaaacaagtttggtaagaagactggttgaaactcttgatagtatcgaggtctct
atctcacatacgacgcggcctatgcgaccaggagagcaacatggaaaagattactttttt
gttgatgaaaaagaatttatctgcatggtcaatgagtgcgcattcttggaatatgctcga
gtttttaaccatttatatggaacttcgatggagcagattaccaaacgtcttaacgaagga
atcgatgtggttttggatattgattggcaaggggctcagcaaatcaggcattcttttcca
gatgcagtgggtatttttattgtgccgccctcattggaagagttgaaacaaaggttgctg
aatcgacgtcaggataaagatgaagtaattagcgatcgcatgaaaaaagcacaggatgag
ctcagtcattattctgagtttaattatttaatcgttaacgataattttgaacgagctgcg
atggaattaggtgcaattgtgcttgcaaaccgcttgcgtatcgagcgacagataaataaa
caagcaaaattgctttctttcctgatgtcatcacagtaa

DBGET integrated database retrieval system