KEGG   Legionella longbeachae: LLO_0906Help
Entry
LLO_0906          CDS       T01183                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
llo  Legionella longbeachae
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:llo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1039573..1040211
Genome map
AA seq 212 aa AA seqDB search
MSIIVGDYLGNLFIVAAPSGGGKTSLVRRLVETLDSIEVSISHTTRPMRPGEQHGKDYFF
VDEKEFICMVNECAFLEYARVFNHLYGTSMEQITKRLNEGIDVVLDIDWQGAQQIRHSFP
DAVGIFIVPPSLEELKQRLLNRRQDKDEVISDRMKKAQDELSHYSEFNYLIVNDNFERAA
MELGAIVLANRLRIERQINKQAKLLSFLMSSQ
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgagtataattgtgggtgattatttaggtaatttgtttatagtggctgcaccttcaggg
gggggcaaaacaagtttggtaagaagactggttgaaactcttgatagtatcgaggtctct
atctcacatacgacgcggcctatgcgaccaggagagcaacatggaaaagattactttttt
gttgatgaaaaagaatttatctgcatggtcaatgagtgcgcattcttggaatatgctcga
gtttttaaccatttatatggaacttcgatggagcagattaccaaacgtcttaacgaagga
atcgatgtggttttggatattgattggcaaggggctcagcaaatcaggcattcttttcca
gatgcagtgggtatttttattgtgccgccctcattggaagagttgaaacaaaggttgctg
aatcgacgtcaggataaagatgaagtaattagcgatcgcatgaaaaaagcacaggatgag
ctcagtcattattctgagtttaattatttaatcgttaacgataattttgaacgagctgcg
atggaattaggtgcaattgtgcttgcaaaccgcttgcgtatcgagcgacagataaataaa
caagcaaaattgctttctttcctgatgtcatcacagtaa

DBGET integrated database retrieval system