KEGG   Legionella longbeachae: LLO_1023Help
Entry
LLO_1023          CDS       T01183                                 

Definition
N-acetyl-beta-glucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
llo  Legionella longbeachae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:llo00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:llo00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1207667..1208809)
Genome map
AA seq 380 aa AA seqDB search
MNSIISLLLLLGISVSCIAHATSEISLRDKIGQMLLIGFEGKEVNSQSPIVKTIEKDNIG
GVILFDYNYHSRNFDKNIETPEQVRQLNNHLQYYTQQANLKHHRPQLPLLISVDYEGGQV
TRLGEQYGFPSVLSAAEIGKKPLNEAEFTAGTMTQTLKNTGFNLNFAPELDVNVNPDNPI
IGKKDRSFSSDPKQIIRYASIYTQQFLNQRIQCAYKHFPGHGSSTKDSHQGFVDVTDTWQ
TYELEPFQQLLNSSASCGMVMTAHLVNRQLDSSGLPATLSHKILTDLLRKQLHFNGVIIT
DDMQMKAISDNYGLEQALVLAINAGADMLIFGNNLPAPPQDPKQVIDLIEAKVNSGEISQ
ERINEAYQHIVTLKKSLKEK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaactccataatctctctattgctgcttttaggtatttctgttagttgtattgctcat
gctacatctgaaataagcttacgtgataaaattggccaaatgcttcttattggttttgaa
ggaaaggaagtcaactctcaatcacctatagtaaaaactattgaaaaagataacattggt
ggagttattttatttgattataattatcactccaggaattttgacaaaaatattgaaacc
ccagaacaagttcggcaattgaataaccatttgcagtattatacccaacaagcaaattta
aagcatcatcgccctcaactaccactactcatttccgtagattatgaaggaggccaggta
actcgattaggtgagcaatacggatttccttccgttttgtcagcagcagaaataggaaaa
aaaccacttaatgaagcagagtttactgctggaacaatgactcaaacgttaaaaaataca
ggatttaatttaaattttgctccagagctcgatgtaaacgtcaatccagacaacccaatt
ataggcaaaaaggatagaagtttttccagtgaccccaaacagatcattcgttatgccagc
atttatacacaacaattcttaaatcaaagaattcaatgcgcttataaacatttcccgggc
catgggagttcaaccaaagattcacaccagggatttgtggatgtgactgatacctggcaa
acttatgaattagagccctttcagcaattactaaactcatctgcctcatgcggtatggta
atgacagcacatcttgtaaatcggcaattggactcttctggattaccagcaaccttatcc
cataaaattctaactgatcttttacgtaagcaacttcattttaatggggttattattact
gacgatatgcaaatgaaagcgattagtgataattatgggcttgaacaggcattagtatta
gcaataaatgcaggtgcggatatgttaatatttggtaataacttacctgcaccaccacaa
gatcccaaacaagttattgacctcatcgaagcgaaagtcaattcgggcgagataagtcaa
gaaagaatcaacgaagcatatcaacacatagttacactaaaaaagtctctcaaagaaaag
tga

DBGET integrated database retrieval system